NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212123_10000744

Scaffold Ga0212123_10000744


Overview

Basic Information
Taxon OID3300022557 Open in IMG/M
Scaffold IDGa0212123_10000744 Open in IMG/M
Source Dataset NamePaint Pots_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)100375
Total Scaffold Genes97 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)69 (71.13%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: Banff, British Columbia
CoordinatesLat. (o)51.1699Long. (o)-116.1578Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000349Metagenome / Metatranscriptome1249Y
F004120Metagenome / Metatranscriptome452Y
F015622Metagenome / Metatranscriptome253Y
F056486Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0212123_1000074417F000349GGAGGMARERRLEARDVEAIFREFTKVMGELPPETEAGWLDAEGDLRLAPDVGRKLRTARNVRDVLRQIRESQGERDGSPF
Ga0212123_1000074423F004120GAGGMRDWVADWKKWTRRERVLAVFVTILMVGLPIGLLLVASVGV
Ga0212123_100007443F015622AGGMRANGVVGSVAALRRKLRGIASLAVDSGATASERENAQAVKKRLEQKLAETEAPAADWTDQAFRLGRWVREFGKSAAPASTHGDWTDHARRLGKAVRRGYKKWSSE
Ga0212123_1000074477F056486AGGAMDQNIVSTPERARGARKAGVVRYVLAVSLLLVVIAFAVAYVTSV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.