Basic Information | |
---|---|
Taxon OID | 3300023020 Open in IMG/M |
Scaffold ID | Ga0233349_1002862 Open in IMG/M |
Source Dataset Name | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-301 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1263 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 40.2526 | Long. (o) | -123.026 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015054 | Metagenome | 257 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0233349_10028621 | F015054 | AGG | MIGMKVEDNLDGATNFIFWKSIVLILEENDLLKLVNEKVPEPNVEEDKSHWRKSDARARRILVDLVRDHLVPQISQKKTT |
⦗Top⦘ |