NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256752_1114264

Scaffold Ga0256752_1114264


Overview

Basic Information
Taxon OID3300023439 Open in IMG/M
Scaffold IDGa0256752_1114264 Open in IMG/M
Source Dataset NameHydrothermal Fe-rich mat microbial community from TAG Site, Mid-Atlantic Ridge, Atlantic Ocean - 665-MMA12
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Delaware
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)629
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location
Location NameInternational: TAG Site, Mid-Atlantic Ridge
CoordinatesLat. (o)26.137196Long. (o)-44.826442Alt. (m)Depth (m)3626.4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096262Metagenome105N

Sequences

Protein IDFamilyRBSSequence
Ga0256752_11142641F096262N/AMGVSTVGTGTDLCTGFKLTGTALQEGDATFMGPAIAQAASGGTGVANCVMQEKTALGVTSGNTLDIQVAVTTAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.