Basic Information | |
---|---|
Taxon OID | 3300024999 Open in IMG/M |
Scaffold ID | Ga0209728_1004055 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Rifle, Colorado, USA - Groundwater D1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6127 |
Total Scaffold Genes | 24 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 20 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus cremeus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rifle, Colorado, United States | |||||||
Coordinates | Lat. (o) | 39.55 | Long. (o) | -107.97 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F091086 | Metagenome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209728_100405518 | F091086 | GAGG | MQNIINTIKVSTNPNEVKQILKPLKIKEVIKVAKVLNVYIRGNENKTEVIGNIILEVVKE |
⦗Top⦘ |