NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209646_1000053

Scaffold Ga0209646_1000053


Overview

Basic Information
Taxon OID3300025246 Open in IMG/M
Scaffold IDGa0209646_1000053 Open in IMG/M
Source Dataset NameArabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)284737
Total Scaffold Genes233 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)153 (65.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location NameUniversity of North Carolina, USA
CoordinatesLat. (o)35.9082Long. (o)-79.0499Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040130Metagenome / Metatranscriptome162Y
F053329Metagenome / Metatranscriptome141Y
F062899Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
Ga0209646_1000053103F040130GAGGMPGSVKRAVAIVAGVVLGMVIAAGASPWRELFRKTEPVQPAPIQREPAPDTRV
Ga0209646_1000053180F062899GGAGMNPLAANRTAARPLPLPRPRAKHCSFVEDLNWPAHMPTPDRKPARPTEVWVPGPNGQWEGVTPTLQ
Ga0209646_100005333F053329AGGAMPLVPQEIGSTPERENPSAHDPALVRDHAAGPDRETLSPSERALAPEGDAPLQSHNAVAADGTYVGQAGGYMGGASPAVESGRAQVNEANRRGDGAYGFPVGPGVGVPGGEHQPAAQKPDDLPCQYPQR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.