NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209640_10003606

Scaffold Ga0209640_10003606


Overview

Basic Information
Taxon OID3300025324 Open in IMG/M
Scaffold IDGa0209640_10003606 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13530
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064925Metagenome / Metatranscriptome128Y
F089941Metagenome / Metatranscriptome108Y
F093175Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0209640_100036063F093175GGAGGMDGLRQIEVITQGDGWHLVGLDAEGRCWFGSPRRTAKGRMLAWILMDESVESEEPPPTMTPEPIEEGRVGRPWPAKPRP
Ga0209640_100036066F089941N/AMVTYTTEDFVRRAVGRLLHDKYHGGAVCSWCLVGMTLERLHTGWRKAEIEQAMEKVFRTPGTLKAMSDGPCSRCKRPTSCLGEPPS
Ga0209640_100036067F064925GGAGMMGEELARCHAGALLRAHPGRYYCARCLTRVLDTAAWTKRDARRAIAMLFRWPIGLTTALREGRDPCGDCGQVGGALLGAV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.