NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209669_101585

Scaffold Ga0209669_101585


Overview

Basic Information
Taxon OID3300025345 Open in IMG/M
Scaffold IDGa0209669_101585 Open in IMG/M
Source Dataset NameThermal spring microbial communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter A (PS_A) MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9069
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013155Metagenome / Metatranscriptome274Y
F075483Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0209669_1015857F013155GGAGVAVIAIALANLAVTVWLLRLLIPIWQTLRKIVFVLDQYDFDKLAKEFLSNEKPLAETIDVKVSEKKEEGYRELTVTRVYRKPLDPREIQENFVRQMAERLQ
Ga0209669_1015858F075483GAGGMIELLAVQAVTTLALAFFVIKLRRELYPMIATAGPAYASFWIRSVDVLVVETPQFEASKVVIKVRWLFSEEIHMTYSFRVYDVAMHPLRRHHYVRWKAWMSGDDRYRCEVEKPRGLSRLYNKAIDVFCKEKEPPKEVVILPSRWRKRRYKQFK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.