Scaffold Ga0208490_101903

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208490_101903

Scaffold Ga0208490_101903

Overview

Basic Information
Taxon OID	3300025514 Open in IMG/M
Scaffold ID	Ga0208490_101903 Open in IMG/M
Source Dataset Name	Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Aug_CSWold (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6804
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (87.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Source Dataset Sampling Location
Location Name	USA: California, McLaughlin Reserve
Coordinates	Lat. (^o)	38.8739528	Long. (^o)	-122.4391613	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050234	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208490_1019034	F050234	AGGAGG	VIPPWPLLVLMLEFPVLMALLDCWQRPEDHFAEGAADRRAWLRWLLVAVVTIPVLVGYGIVLGYYYAVVRRSSPASPR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.