NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207702_10000202

Scaffold Ga0207702_10000202


Overview

Basic Information
Taxon OID3300026078 Open in IMG/M
Scaffold IDGa0207702_10000202 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)70333
Total Scaffold Genes80 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)55 (68.75%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049823Metagenome146Y
F064160Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0207702_100002023F049823AGGAVPPQPVQGSFEVARGVVPQERTDDALRLLHLDLLQRGASATELSEWLWGMHWFPHLREREEIFALAESLPQEWRTGRPCEPQILLQFPHTGPEPEIQFHLDQEPAWAGESAYLRIVGVPLSSWRGDNGGLLVKTAEGPAPVEADPGDAIRMTPDLPHSGGVNRTGSLRYGVYFRWLAE
Ga0207702_1000020247F064160N/AVKLLLIPFVVIAFVVFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARSGRSA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.