NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209152_10000250

Scaffold Ga0209152_10000250


Overview

Basic Information
Taxon OID3300026325 Open in IMG/M
Scaffold IDGa0209152_10000250 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)27297
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (90.62%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009257Metagenome320N
F011744Metagenome / Metatranscriptome287Y
F088665Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0209152_1000025018F011744GGAGGMEKLKPGDRVWVKNPRSVAERKIGTIMSTKKTRNGQRYIVEWDVDLEETPNHHPGYLEKEIAPMNRRGISK
Ga0209152_1000025024F009257GGCGGMAKYAVMVLEFIKKDVFEDRKQVSVEEVVTLIAALTDISVSLLSRFRKDQVDPTKTTEVGRDVFKYMVGRLGFDIDKLGKSNIYV
Ga0209152_100002507F088665GGAGGLFGAASIFSGNATGPTWLAIVVVFFGILGLSLGVGFYTGTRWAWMGGIVIYIVSILLGILEILYGGTVGGIGGVIRMVAGIVIPLYLTRAGPKSFFGKGRAAHSS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.