NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209802_1000030

Scaffold Ga0209802_1000030


Overview

Basic Information
Taxon OID3300026328 Open in IMG/M
Scaffold IDGa0209802_1000030 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)85683
Total Scaffold Genes97 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)75 (77.32%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008300Metagenome / Metatranscriptome335Y
F016382Metagenome / Metatranscriptome247Y
F104897Metagenome100N

Sequences

Protein IDFamilyRBSSequence
Ga0209802_100003045F104897AGGCGGMSIPIRMGRTEIGTIYLLAMVFLAAVLAILGVVYNDAWAKGGVVAAVGISILLYWSITKEKKSLTP
Ga0209802_100003069F008300GGGGGLEIRMKHFTEIENFTFLAHVLGHELGGTTPRPIRTVTDLQVPDEEFQNFVNTAKTASLTDEELADSTLDVGINWEHFVASNDNLLLPDHPLKISDVQMQEKVDSLDFITEAFVREINIRSIEKQTGTKTRKSHE
Ga0209802_100003080F016382AGGALRSPLTEIFYETLEYCFGKTLLETLGPTVQASIYDLLKRSGIRKEDISNRFDDVVQALTSTLGTCSRVVVHRTVVEMFKEYSQRLDFSYTDSLRDRLAVLKEAVVANHVLPRRLRDESAFDSVEKPEWTGPDVPKGQAYNSLYPMKKGVKT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.