NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208897_1010290

Scaffold Ga0208897_1010290


Overview

Basic Information
Taxon OID3300027571 Open in IMG/M
Scaffold IDGa0208897_1010290 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2843
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Columbia River Estuary
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000980Metagenome / Metatranscriptome814Y
F100400Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0208897_10102901F100400AGGAGGMASFLEDVNQMVIDACYQEIAEQLLEQWINNNLDEGQYYAD
Ga0208897_10102907F000980N/ATRMTHYQKYTWVCTGDCDALIEYTIKDGFGWPNGVMQLTCPCNSRCTLVSVEDATIPYTDTPLTKEEPMEESTVTTTPIPESYNSNLLVTYKVIRGYSDAEYATDKVTSIEWDLHNGRQAQKRVTTLLSQIDAVKEIICEAYADSGDQDTLRAIAEALSIELIKEVLFTASIEVSGTYSYNILDSDYELDLDSEVYDALYADSNNGNIEINDTEVCNVREC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.