NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209420_1158170

Scaffold Ga0209420_1158170


Overview

Basic Information
Taxon OID3300027648 Open in IMG/M
Scaffold IDGa0209420_1158170 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)618
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050243Metagenome / Metatranscriptome145Y
F062620Metagenome / Metatranscriptome130Y
F085928Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0209420_11581701F062620N/AELEKSLRALVLVSLEPLKQKQQITILDKAGFGQSEIAEVVGSTPKAVSVRLAEIRKEARKGKSK
Ga0209420_11581702F050243AGGAGGMDKDVRGQILATLQDLLIFQMAAKGVAQDQIRKAVGLDMNRVSRIAKLAKRSAKSEE
Ga0209420_11581703F085928AGGAGMPTEGTERLIELLEKALMIHLHSMKVAQGDIAKMLNKRKADVNDFLKPVAKGKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.