NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209972_10022355

Scaffold Ga0209972_10022355


Overview

Basic Information
Taxon OID3300027793 Open in IMG/M
Scaffold IDGa0209972_10022355 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3829
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (86.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003663Metagenome / Metatranscriptome474Y
F004840Metagenome / Metatranscriptome421Y
F008241Metagenome / Metatranscriptome336Y
F080027Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0209972_100223551F080027N/AYRSNSRHFSGEIVSAEPRPEIYYGEKTEAYLIEIRTGGLRNKFATIAVKVGE
Ga0209972_1002235512F003663GGAMLSTAIEILDATKSSIFDEDIMGLAGELHTRRNELSDEIYAKYLFMYSSALSAKVADSITKILLTEQEMSDLVATIDEMDDLSETILEENE
Ga0209972_1002235515F008241GGAMSRGKSISVKIATPKVIKALETRLAELEKNYKAQGENEAKHTKAHEAWKKEVGKWAIANFSKAENLRTNY
Ga0209972_100223555F004840N/AMYKLTCAYDSNAPHWSAEYENEFGAWENFFRFTDWGSANEYSTVNLSTPTGKCYTKLFYRSGEVVVK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.