NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209107_10076489

Scaffold Ga0209107_10076489


Overview

Basic Information
Taxon OID3300027797 Open in IMG/M
Scaffold IDGa0209107_10076489 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1834
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (12.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003299Metagenome / Metatranscriptome495N
F003327Metagenome / Metatranscriptome494Y
F009004Metagenome / Metatranscriptome324Y
F015420Metagenome / Metatranscriptome255Y

Sequences

Protein IDFamilyRBSSequence
Ga0209107_100764893F003299N/AMCQLKMIAMKMYKVVFKTFDYWNGPVKLVTRIIEAYDRDHVKQLIQKNDDLILLIEEI
Ga0209107_100764894F003327GAGMINEFTQLAIKVQDEIANGDYTHQKYLQFREWYFQNYEGSKRNANRDFAMFDLMYGLDVPIKNDSNEDV
Ga0209107_100764897F015420N/AMKKLINYFTPVGEEQIAFAKALMVVFTAIISILFLFTFLELIS
Ga0209107_100764898F009004N/AMKTFNQILDYLEVQQQEDKLTTNQLHLIIQTLTTFLNKEQLQEIENLFNQFKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.