NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209526_10037468

Scaffold Ga0209526_10037468


Overview

Basic Information
Taxon OID3300028047 Open in IMG/M
Scaffold IDGa0209526_10037468 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3415
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002783Metagenome / Metatranscriptome530Y
F074837Metagenome / Metatranscriptome119Y
F096819Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0209526_100374681F096819GAGMRLQIIEPGLSPELTGDLDGIDAGRLPPRPLVAGAMDRAVMRAAERDGEFVARFAA
Ga0209526_100374682F074837GGAGGMYENCTIPTFELCVQEVIAGNRGFCIPNPRWQAPGPAARQPRGQRRRVDY
Ga0209526_100374683F002783GGAGGMKRALIGGLSVLAMIVGVSAANAQANINPNLYPGNTSGPYGAQAPWEWHGAPGPNKRGNMCVTHVDPMRGYGYQAPCPAPKKAAAAPKAKRKKVASR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.