Basic Information | |
---|---|
Taxon OID | 3300028237 Open in IMG/M |
Scaffold ID | Ga0302338_1045907 Open in IMG/M |
Source Dataset Name | Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Reed Canary Grass, Gen10, Rep 2, Chloramphenicol (External Submission) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 976 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Chytridiomycota → Chytridiomycota incertae sedis → Neocallimastigomycetes → Neocallimastigales → Neocallimastigaceae → Neocallimastix | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 34.4149 | Long. (o) | -119.841 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046107 | Metagenome / Metatranscriptome | 151 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0302338_10459071 | F046107 | N/A | MYFGKLYYAGIFPFLSNKKEIKFRSNILKIDSVVSTKLSPDSSFIELLGRESPFVVIDDNPVLSLCLISTTATLLVKFDILQYLSNNSSKN |
⦗Top⦘ |