 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300028237 Open in IMG/M |
| Scaffold ID | Ga0302338_1055192 Open in IMG/M |
| Source Dataset Name | Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Reed Canary Grass, Gen10, Rep 2, Chloramphenicol (External Submission) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 783 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.4149 | Long. (o) | -119.841 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F098130 | Metagenome / Metatranscriptome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0302338_10551921 | F098130 | N/A | MPDPHPRRRLGGDDPFERRHVRDWAPPGWHWEVLPSGARNLVRNRGLVVDPELLWWQSRGPLAVQREPAPEEVVRRRVREEDEHVRRYMVALDDRFSNTWQFLQGSHPSYVPVMVPSLWVMTARGSGTGRRRPV |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |