Scaffold Ga0302338_1055549

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0302338_1055549

Scaffold Ga0302338_1055549

Overview

Basic Information
Taxon OID	3300028237 Open in IMG/M
Scaffold ID	Ga0302338_1055549 Open in IMG/M
Source Dataset Name	Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Reed Canary Grass, Gen10, Rep 2, Chloramphenicol (External Submission)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	778
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.4149	Long. (^o)	-119.841	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002654	Metagenome / Metatranscriptome	539	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302338_10555491	F002654	AGG	MLNYQTFNEKVVCQKGNSPEQVFKVPKFLLSESKEVFKLYNQEIGLEAAIF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.