NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233377_1013191

Scaffold Ga0233377_1013191


Overview

Basic Information
Taxon OID3300028483 Open in IMG/M
Scaffold IDGa0233377_1013191 Open in IMG/M
Source Dataset NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2253
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041521Metagenome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0233377_10131911F041521N/AVDSGAGGFIGKIQENSSEVTIRNCAAYGTIKTNYAKNSFNNTPTIYMGGFLSFSNTNAQTTLENCLFAGKFEKGSNLTDEAFLGAFGTLRSVKAIKNCYYLADDGLAAVHSDSNLKPGSDNVEITAVTEDDLRNNTIATQLGTLWEQGENYPVIRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.