Scaffold Ga0268357_105787

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0268357_105787

Scaffold Ga0268357_105787

Overview

Basic Information
Taxon OID	3300028580 Open in IMG/M
Scaffold ID	Ga0268357_105787 Open in IMG/M
Source Dataset Name	Sewage microbial communities from Oakland, California, United States - Biofuel 10 (Illumina Assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3505
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (87.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Sewage → Sewage Microbial Communities From Oakland, California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	37.82	Long. (^o)	-122.29	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025048	Metagenome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268357_1057876	F025048	AGG	MLNPTLITDAIASVLLSIPELYAAMGGRITAFHYRLGQEHRLAEAIYKMPAPSMLIVWEGTKGGSFDGQTIWKHRWGVYYRMGNAAGVAEPVGYEDLWWITCNCPPGGSGPNIRYLQLYPGLDIMDTPSIDHELDEDLIDRFKGLFIIPEIGDN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.