NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0268360_1013831

Scaffold Ga0268360_1013831


Overview

Basic Information
Taxon OID3300028582 Open in IMG/M
Scaffold IDGa0268360_1013831 Open in IMG/M
Source Dataset NameSewage microbial communities from Oakland, California, United States - Biofuel 11 (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2210
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Sewage → Sewage Microbial Communities From Oakland, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.82Long. (o)-122.29Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083634Metagenome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0268360_10138312F083634GGAMYIMLKMADQIISLDRIKINGRVCRLARKLIVTVEHEDDRLTLSNEEFGLVVSAETLEEGIAGISEELAVLWEVYVDEDPANLTADALRLRSNLTSLVPAGASL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.