NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307503_10000001

Scaffold Ga0307503_10000001


Overview

Basic Information
Taxon OID3300028802 Open in IMG/M
Scaffold IDGa0307503_10000001 Open in IMG/M
Source Dataset NameSoil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)484270
Total Scaffold Genes493 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)333 (67.55%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)46.6992Long. (o)-120.899Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002483Metagenome / Metatranscriptome555Y
F017066Metagenome / Metatranscriptome243Y

Sequences

Protein IDFamilyRBSSequence
Ga0307503_10000001263F017066GGAGVTLPLAHHAAVAALPVFLPALIVCAVLLVHFLRERRHWDEEGDGDSA
Ga0307503_10000001264F002483GGAVPELPALRRRRRRAAPRRDATAVARAPAYYRVAEVALDAELERLCGLPVFAGGPLAERRPQLTVRRARSRPNRVGFAVPTQFRLSVTAYPGIRPGDVLETLLHELVHLHVGRAQEARAWHGATFKQALAQAMAEAYGVDIPPPPSSLHGAYAAAIERLLAGGVGPGPALASG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.