NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307503_10000027

Scaffold Ga0307503_10000027


Overview

Basic Information
Taxon OID3300028802 Open in IMG/M
Scaffold IDGa0307503_10000027 Open in IMG/M
Source Dataset NameSoil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)137045
Total Scaffold Genes143 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)102 (71.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)46.6992Long. (o)-120.899Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007832Metagenome / Metatranscriptome344Y
F050351Metagenome / Metatranscriptome145Y
F061187Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0307503_1000002783F007832GAGVVSFADIFPGGGGPFADVFAIALSVVLFALVYWAIDLIDRI
Ga0307503_1000002784F050351N/AMSGAVLATLSGVDVFGLAASVLVVAYLLYALLRGEKL
Ga0307503_1000002794F061187AGGAGMNDPPSKTTFVSRGRLNGVLRQGPPGGGLAEGSGTQPGRERGSVDELDTQTFEALYYRARLILGEPLPRPGRFQLRGH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.