Scaffold Ga0239302_114661

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0239302_114661

Scaffold Ga0239302_114661

Overview

Basic Information
Taxon OID	3300029314 Open in IMG/M
Scaffold ID	Ga0239302_114661 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from Sewage Treatment Plant in Aalborg, Denmark - MBR_Gel1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Aalborg University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	990
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Comammox Microbial Communities From Various Environments And Locations In Europe

Source Dataset Sampling Location
Location Name	Denmark: Aalberg
Coordinates	Lat. (^o)	57.049957	Long. (^o)	9.865377	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078309	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0239302_1146613	F078309	N/A	MTLPLRIELAMTFKAVFPDILAPARSGQGRPGAVEAVSGCNILILPLDASNLRP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.