NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265601_1032186

Scaffold Ga0265601_1032186


Overview

Basic Information
Taxon OID3300029683 Open in IMG/M
Scaffold IDGa0265601_1032186 Open in IMG/M
Source Dataset NameMetatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_120m (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)596
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameCanada: Sakinaw lake, British Columbia
CoordinatesLat. (o)49.68Long. (o)-124.009Alt. (m)Depth (m)120
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064398Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0265601_10321861F064398N/ATVTLKKLCVMALCTFLLTLAFSGVGNAAPEETPSVYYLEYGGLKIDIRAPDQDYPDENITVTVKTEAVVPQIYVKYINVDLYGVVNATTEVILDQISHLKNSSLSSHEVQYNITIPDNLSPGLTYGIISYEWEFMGSPQKIPPSGFALTYIKNVELEQLQAEYDELNATYQTLFQDYTGLESGLKEEMDSTRNLMYVF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.