Basic Information | |
---|---|
Taxon OID | 3300029896 Open in IMG/M |
Scaffold ID | Ga0247044_1045700 Open in IMG/M |
Source Dataset Name | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-C3b |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DMAC, Technical University of Denmark |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 964 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Greenland: Tasiilaq | |||||||
Coordinates | Lat. (o) | 65.38 | Long. (o) | -38.53 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023612 | Metagenome / Metatranscriptome | 209 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247044_10457001 | F023612 | GGAG | MGHSHSTGRRARPRLQWTVAASLATSMIGAQAEGLTLRLQESSYGSNSSAEYALTNYRAPANSIRLFGDYYFFDPAQSNGGPMTSSLMGGFRASTGVVGLAQPMSLYETRPDPLQNLPYIGLGYSHLYLNSQLSLNADFGLASQSNHGRGLFGSTSALDDVTNQLRWAPVMAVNVRYSF |
⦗Top⦘ |