NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247058_1001868

Scaffold Ga0247058_1001868


Overview

Basic Information
Taxon OID3300029902 Open in IMG/M
Scaffold IDGa0247058_1001868 Open in IMG/M
Source Dataset NameCryconite microbial communities from ice sheet in Thule, Greenland - THU-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDMAC, Technical University of Denmark
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13270
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (83.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location
Location NameGreenland: Thule
CoordinatesLat. (o)76.23Long. (o)-68.15Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083559Metagenome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0247058_10018687F083559AGGMNDCAVSDALTHPPSSRPPRPALVDLHILPHTIHEFGVEARKAGKSWEAAFNGPIQSWEDPETQQATYGVTVRLSRIKDPFTRELYSTNILFYLPEDAMHGMHNVYDMAQRFPFTRIRGPRTAPPLCPPRAGMLWYDANPEGVIMEDVRQSPAMLPDGRPGFFVTGQGYRGKVVLPDGLFIHDVGVYGGYLDPLERPAQLELQHLFGGIEFVPGKTGTQEDLFLTELGDGVWVKGIVGNAVDELHVESYKNSVRLPCPHAGKFLIGARSMSETKLLPYFESRDPNGLGSYALSGFVDCLPKAIGPDVWERVHRVGLGSNFIPSPEIGGHIGLIHVVLERNNPDYPETHDPSYPKIEEQYEGWVVWLDFDESGTPHVKSCLRALTPDDVPRCYQGAGELFDTKRVAFPISLYRIGDNLRVGYGWGDRALFQAEYDYQTVVRHLAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.