Basic Information | |
---|---|
Taxon OID | 3300029902 Open in IMG/M |
Scaffold ID | Ga0247058_1002171 Open in IMG/M |
Source Dataset Name | Cryconite microbial communities from ice sheet in Thule, Greenland - THU-2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DMAC, Technical University of Denmark |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 12114 |
Total Scaffold Genes | 17 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (82.35%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Greenland: Thule | |||||||
Coordinates | Lat. (o) | 76.23 | Long. (o) | -68.15 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F083425 | Metagenome | 113 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247058_10021711 | F083425 | GGCGG | MSTTRTGHDFDTQSLATTGARAILRAETIAAWLSTEELEEVEAAAKRSGKSLAEWLRDTALVGA |
⦗Top⦘ |