Scaffold Ga0247319_1002315

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247319_1002315

Scaffold Ga0247319_1002315

Overview

Basic Information
Taxon OID	3300029904 Open in IMG/M
Scaffold ID	Ga0247319_1002315 Open in IMG/M
Source Dataset Name	Fecal microbial communities from Lean line chicken in Harbin, China - MGJ1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Inner Mongolia Agricultural University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11300
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	15 (88.24%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Birds → Digestive System → Fecal → Unclassified → Fecal → Fecal Microbial Communities From Lean And Fat Line Chickens In Harbin, China

Source Dataset Sampling Location
Location Name	China: Harbin
Coordinates	Lat. (^o)	45.73	Long. (^o)	126.73	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036964	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247319_100231513	F036964	GAGG	MISFLKIAFPALMVIGALGSLVVNIISKGDKATSLQWIGASLLYTALLFRNK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.