Scaffold Ga0257205_1078160

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0257205_1078160

Scaffold Ga0257205_1078160

Overview

Basic Information
Taxon OID	3300030559 Open in IMG/M
Scaffold ID	Ga0257205_1078160 Open in IMG/M
Source Dataset Name	Metatranscriptome of plant litter fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-LITTER (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	682
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Decayed Wood Fungal Communities From Pinus Contorta In National Forests From Montana, United States

Source Dataset Sampling Location
Location Name	USA: Montana
Coordinates	Lat. (^o)	46.9233	Long. (^o)	-110.8694	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065397	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257205_10781601	F065397	AGG	VQIRVFVSLLYSPDNLTLKMAIQKTTVTTDRKWLEIAPPRRVCAGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDNERFTSTEC

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.