NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307925_100388

Scaffold Ga0307925_100388


Overview

Basic Information
Taxon OID3300030714 Open in IMG/M
Scaffold IDGa0307925_100388 Open in IMG/M
Source Dataset NameMetatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - UN-1 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4814
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location NameFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031354Metagenome / Metatranscriptome182Y
F059653Metagenome / Metatranscriptome133Y
F091296Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0307925_1003885F059653N/AMNNKAALQSLTEYKNDNLLEKLLLDRGVVTGGTYAAANAKDIDLAAASLYFTLAAHPELKEGAFSIKYSGAQLIAMAKRILKKYDMDEPTVDGAAIW
Ga0307925_1003886F091296GGAGMVVERYPHTATINYYTPGTYNTIGIYTEGTLVTIGIVCNIQPNSTKYIIGESGDMIGYSWAVFSPVFAGARSVPKAAKLTFFSKEHIILQLFEYQKHVEMKC
Ga0307925_1003888F031354AGGAMKTTFDINDILYPVINTEEVQAILDGGRVYRNKKPLNSELQDIVIIPLSNYVGDEIINDATFMVNCYCKNFNNGAPNITKLRAIAKAVIDEIELYNSAPNYYVFGIVNQILLNDIDQKSMSYVNLRINCFIEK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.