Basic Information | |
---|---|
Taxon OID | 3300031280 Open in IMG/M |
Scaffold ID | Ga0307428_1008880 Open in IMG/M |
Source Dataset Name | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3724 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Massachusetts | |||||||
Coordinates | Lat. (o) | 42.759 | Long. (o) | -70.891 | Alt. (m) | Depth (m) | 2.4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038774 | Metagenome / Metatranscriptome | 165 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307428_10088803 | F038774 | AGGAG | MRKYVLAAVLVAAFATPAFAEQFYVAFDPASHKCTMMHSIPGDDMKNMGGPYATEAEAHKAMAGMEACAN |
⦗Top⦘ |