NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307445_10199866

Scaffold Ga0307445_10199866


Overview

Basic Information
Taxon OID3300031364 Open in IMG/M
Scaffold IDGa0307445_10199866 Open in IMG/M
Source Dataset NameSalt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)703
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.722Long. (o)-70.891Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007803Metagenome / Metatranscriptome344Y
F071206Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0307445_101998661F007803AGCAGGLIVVLLFAFADPALAKWWIVRASDETCLVVDIEPKGNDKAVTKVGNDVYETSEQAEAGVKRLCKVSKGKDQSRDPGNAE
Ga0307445_101998662F071206N/APVEQLADNALIARKFRALGFSKVHVSGAGATRRVEGVWPGKDMSATMPPQIVAVATLR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.