NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318516_10028653

Scaffold Ga0318516_10028653


Overview

Basic Information
Taxon OID3300031543 Open in IMG/M
Scaffold IDGa0318516_10028653 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2919
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000461Metagenome / Metatranscriptome1108Y
F013297Metagenome / Metatranscriptome272Y
F074264Metagenome119N

Sequences

Protein IDFamilyRBSSequence
Ga0318516_100286532F013297GAGGMKWPHHRNLRNRPPTPSKGRGPVQVRIRRAFIASGAEVLSSTQIYDWTHSRRRQSRRKKLPFGVYWRTLKTLRAMCDPIERVPPHGAWLWRLRNDVAARWR
Ga0318516_100286533F000461N/AMTALTAMDKLLFWLGIGAAQKGARSKDVKPSRHWVISLVAGILLALLIAAGMFILLVSQQ
Ga0318516_100286535F074264GGAGMHNLTCAACGRALAETSAWKGSGERLYCNDFCAEAEEADINLIRYAVSTKSPEHLAH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.