NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318541_10037065

Scaffold Ga0318541_10037065


Overview

Basic Information
Taxon OID3300031545 Open in IMG/M
Scaffold IDGa0318541_10037065 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2452
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013567Metagenome / Metatranscriptome270Y
F014463Metagenome / Metatranscriptome263Y
F068884Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Ga0318541_100370653F068884N/AVTFKQWIEAEPVRPLHQDHARYAAYGAAPPTQDDPLTVGKYSDLPALLDGYHRAVQFWSRNDPDATLPVYVPFEAKEALHLSDLF
Ga0318541_100370654F014463GGAGGMGNGYLPAAPGKNPGPPARQSAVRGEDVIYISICSGGPIIKISAVDRPTFVLGQLIILGAIVVVALVELILWLVN
Ga0318541_100370655F013567GGAMALLSIRMKQKIGPVAEVLGWIFVLSLVLGPWIAWFIGEPNIVREGELCGPGYRWTYAQPRFADSDLSCEPE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.