NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308418_1001624

Scaffold Ga0308418_1001624


Overview

Basic Information
Taxon OID3300031783 Open in IMG/M
Scaffold IDGa0308418_1001624 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11647
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004791Metagenome / Metatranscriptome423Y
F005302Metagenome / Metatranscriptome405Y
F005631Metagenome / Metatranscriptome394N
F081390Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0308418_100162413F005631GAGMRLSVSVDVDNALRKLLPRSAQIEAALDAGAAAAHGVMQVYPPPPAGSRYRRTGNLRQKLRIKKLSKTSRIVENTASYARFVYGMPQARVHRGRWASVRDAAEAAKKEAIAVLKERGR
Ga0308418_10016245F081390N/AMRRNQRLMPPFRAQRCEMLRDALKRQTVKRVGRAMVDVPTQH
Ga0308418_10016246F004791GGAGGMNKPAEIFDIDAIRVDRAALSIRDAASVLNNELTAPVVARLVRKAIGDQADQFPLRALKAVYERVLPQIFEPDEAVRSRVAGLVPAVGEITLGEYHEFLDASERKIAFPPVAATLLIKAYGEEILNEPYAAAALLLKKIFDSIGDEGNE
Ga0308418_10016247F005302AGGAGGMAHSGVLAGLFAGNFAVEISTNNTTWTAVSNATVKIDDVELNRPSGEAFVGGSSDYATITIGKREPVEITLTFLYNEAANSATNTIFDQFQSTTPRLGVRWSPRGLTSGARAYGTSNDGGTTFGLGVITNVTLSTLDPSDPEPYVAMVTVRTPSLRQYALGANPVDLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.