NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308417_1010856

Scaffold Ga0308417_1010856


Overview

Basic Information
Taxon OID3300031950 Open in IMG/M
Scaffold IDGa0308417_1010856 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5058
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002970Metagenome / Metatranscriptome517N
F004791Metagenome / Metatranscriptome423Y
F005302Metagenome / Metatranscriptome405Y
F081390Metagenome / Metatranscriptome114Y
F105262Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0308417_10108561F105262AGGAGGMLVQETIQPLLRFFNANVTAPADTSVISIANAQAVRIVAHTGTVTGSASLQVHVNDTNNTNNSAQLTDKAIATLTSNSSYEIFVTGAEAYAAKTHASHMFVRIAGTGTAQIAIEISAFPARDVPATLPTGWTRVL
Ga0308417_10108563F002970GGAGMSYSSVTDIIELLAGLAVQYNSAVVPVRRLASQPNWSDAAQLPVRIIPALGGLRLVEGGVYTPTRATRAVWEIDDLLLVRDVGMGRGVADTATALVDYIEDYVARLRFAWLARGDVQLLNVSGIIDVIRYGERAYEGVAMTTRFAHLVRAPSV
Ga0308417_10108564F005302AGGAGGMSHSGVLAGLYAGNFAVEISTDTTTWTAVSNATVKIDDVELSRPSGEAFVGGSSDYATITVGKREPVELTLTFLYNEDTNSAANTIFDQFQSASPRLGVRWSPRGLVSQARAYATSNDGGANTGLGVITNVTLSALDPSDPEPYVAMVTVRTPSLRQYTLGNNPTNLS
Ga0308417_10108565F004791AGGAGGMSTPANIYDVDAIYVDRNALLIRDAATLLNRELTPETIARLVRRAIGNQADLFPIRALRRVYERVLPQIFEPDAAIRARVEGLRPNVATITLGEYHQFLDASERRIAFPEVAATLLIKAYGEDILNEPYAAAALLLKKIFDSIGDEGNG
Ga0308417_10108566F081390N/AMRRDQRLMPPFRAQRREMLRHALQRQTIKRVGRAVIDIST
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.