NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335072_10003109

Scaffold Ga0335072_10003109


Overview

Basic Information
Taxon OID3300032898 Open in IMG/M
Scaffold IDGa0335072_10003109 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25198
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (90.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000628Metagenome / Metatranscriptome973Y
F015939Metagenome / Metatranscriptome251Y
F026686Metagenome / Metatranscriptome197Y
F077875Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0335072_1000310922F000628AGGAVRPVAIRRNVGFDVFNVRLLIGMDKLLRKKRRYQGDLSASINDALLAVNLNTVKLITLQGRKKQTARETQVVILRRLIRRIKRIADARGCSINQLVNSGLLAYYSKQRRTKLDGASRTARGASMASYDKMSTAERQQLMEFLASLSGLQEGPHEEFPDGTHYEYDRDLKTTVEVAPSGKRFLVALVGGKLQRDTEKALAQRTTR
Ga0335072_1000310924F015939GGGGGMATYDEMNTVERQQWMEALASLTGLEEGPHDELPDGTYYEYDPTLKTTVEVTPSGERFLVVLVGGKLQRESRSAAAQEISQ
Ga0335072_100031095F026686GGTGGVGTVDAKKLTSEVAARHGLLIREDDPAMALVTMSEIVLEQVLEKAEAGLRNVLSDVEKSQTGAQQEALVRVQEQMDRAGDALCVRVQRDIDAGRLQAKELVVQLSQVYSRSAVRRWVALGIVCGLVLLLIGVGLGLELGRWLR
Ga0335072_100031096F077875GGAGMRFLLGFVFGAYYAGDRVFRITFLLIILFMTFCLYEMSKPLGHNRPKPAPVVKAQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.