NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335072_10038675

Scaffold Ga0335072_10038675


Overview

Basic Information
Taxon OID3300032898 Open in IMG/M
Scaffold IDGa0335072_10038675 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6545
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013580Metagenome / Metatranscriptome270Y
F047226Metagenome / Metatranscriptome150Y
F090932Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0335072_100386752F013580N/AMAGFMLWLSVVVDEACTQIWEAWGSGASVTSLRVSPAVYTAVATARPMETARDYPLMLLGLPLVADREVATYAPVVVRKETSC
Ga0335072_100386757F090932N/AMSKIKRWLDKRRVVWAEPALPKYVKINPLSPPGAAAGVQPGDFSMLQIAEEFLEGDEEFGEAPDEGPALP
Ga0335072_100386758F047226GGAGMALQESAGRSHQALHAANERRSAEASRRNRKLAATALMRLGEDCPTEWEDVALEVILHSQYSWSQIARRLGVTRSQAVYRFRRLLRAAHVERSALPDL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.