NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334900_1009330

Scaffold Ga0334900_1009330


Overview

Basic Information
Taxon OID3300033166 Open in IMG/M
Scaffold IDGa0334900_1009330 Open in IMG/M
Source Dataset NameSludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_31_08-R3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5165
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands

Source Dataset Sampling Location
Location NameNetherlands: Wageningen, Gelderland
CoordinatesLat. (o)51.9691Long. (o)5.6654Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055749Metagenome / Metatranscriptome138N

Sequences

Protein IDFamilyRBSSequence
Ga0334900_100933010F055749AGGAGGMAKRAENPMNLIMIIAVGILTLVAIITVGPVVGGSIELAMPAVAADSPWNATTNDDLPDGAVTWAQLIPLVVLAVLALIIGLVIMYFRNAAR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.