Scaffold Ga0316587_1118151

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316587_1118151

Scaffold Ga0316587_1118151

Overview

Basic Information
Taxon OID	3300033529 Open in IMG/M
Scaffold ID	Ga0316587_1118151 Open in IMG/M
Source Dataset Name	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	518
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location
Location Name	USA: Alabama
Coordinates	Lat. (^o)	30.2619	Long. (^o)	-88.2383	Alt. (m)		Depth (m)	.05 to .07
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008512	Metagenome / Metatranscriptome	332	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316587_11181511	F008512	N/A	QLLLCISTMQAALAGLIENKDQGPPKEKRRKADKKSASIGKQHGNSAGSVKNFRAPAMLKTAPLDCEIKRNLREKRRDPWPRANAPSKAVADPELVVKTRQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.