NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2077657000

2077657000: Sulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B1



Overview

Basic Information
IMG/M Taxon OID2077657000 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0046169 | Gp0051733 | Ga0011065
Sample NameSulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B1
Sequencing StatusPermanent Draft
Sequencing CenterMogene LC
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size29898767
Sequencing Scaffolds11
Novel Protein Genes11
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis2
All Organisms → cellular organisms → Eukaryota2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1
All Organisms → cellular organisms → Bacteria3
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSulfur Spring Sediment And Crust Microbial Communities From Zodletone, Oklahoma, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Warm (34-42C) → Sediment → Sulfur Spring Sediment And Crust → Sulfur Spring Sediment And Crust Microbial Communities From Zodletone, Oklahoma, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → sulfur spring → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Surface (non-saline)

Location Information
LocationSouthwest Oklahoma
CoordinatesLat. (o)35.100293Long. (o)-98.749601Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001024Metagenome / Metatranscriptome803Y
F001679Metagenome / Metatranscriptome653Y
F035850Metagenome / Metatranscriptome171Y
F037503Metagenome / Metatranscriptome168Y
F092248Metagenome / Metatranscriptome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
ZODLETONE_B1_GLDH0LQ01AET48All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis555Open in IMG/M
ZODLETONE_B1_GLDH0LQ01AKFDCAll Organisms → cellular organisms → Eukaryota507Open in IMG/M
ZODLETONE_B1_GLDH0LQ01ARMABAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
ZODLETONE_B1_GLDH0LQ01B4C9DAll Organisms → cellular organisms → Bacteria541Open in IMG/M
ZODLETONE_B1_GLDH0LQ01B64DDAll Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis539Open in IMG/M
ZODLETONE_B1_GLDH0LQ01B67MFAll Organisms → cellular organisms → Eukaryota507Open in IMG/M
ZODLETONE_B1_GLDH0LQ01BJYKNAll Organisms → cellular organisms → Bacteria511Open in IMG/M
ZODLETONE_B1_GLDH0LQ01BMN8BNot Available568Open in IMG/M
ZODLETONE_B1_GLDH0LQ01BNQ8AAll Organisms → cellular organisms → Bacteria531Open in IMG/M
ZODLETONE_B1_GLDH0LQ01BPG9QNot Available554Open in IMG/M
ZODLETONE_B1_GLDH0LQ01CDZQUNot Available527Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
ZODLETONE_B1_GLDH0LQ01AET48ZODLETONE_00099710F001679LLSFPPATKGVWGMSWRQEAKKGVEDCDKPGGLVKRELIPGYPNDSGMNP
ZODLETONE_B1_GLDH0LQ01AKFDCZODLETONE_00528240F092248TPRLLLRLLLPLSDKVYFYFHDRVEPGHGPLGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
ZODLETONE_B1_GLDH0LQ01ARMABZODLETONE_00259400F035850EVTDAMLPRKASRELNGARTQTNTGGQVENTEAIEITLVKELGKLTA
ZODLETONE_B1_GLDH0LQ01B4C9DZODLETONE_00156660F037503MPLGAASWLSVIEVELPIGCEGFTTYQSLTNSECYNIYTGVRRWVLRSGAERERTQTIS
ZODLETONE_B1_GLDH0LQ01B64DDZODLETONE_00556880F001679TTTPVSWHQEAMKGVEGCDKPGGAVKQALIPGFPN
ZODLETONE_B1_GLDH0LQ01B67MFZODLETONE_00391710F037503MLLGAAWRLSLTEVELPIGLGGVKSYQILMNSECRKIYSAVRVGVLRSQSEREVVV
ZODLETONE_B1_GLDH0LQ01BJYKNZODLETONE_00838140F037503MHLGAASRNSVVEVELLIRLEGFTAYQTLINSECYDIYSGVRRWVLRSSAERERTQTIS
ZODLETONE_B1_GLDH0LQ01BMN8BZODLETONE_00037740F001679WHQEAMKGVEVCEKLGGVDKQMMIPRFPNQHVLNP
ZODLETONE_B1_GLDH0LQ01BNQ8AZODLETONE_00234340F035850EVTDAMLPRKVSREIVGARTQTNTGGQVENTKAIERIPVKELGKLAA
ZODLETONE_B1_GLDH0LQ01BPG9QZODLETONE_00427330F001679HDDWGMSWRQKAKKGVEVCEKLGGVDKRAMIPRFPN
ZODLETONE_B1_GLDH0LQ01CDZQUZODLETONE_00420730F001024MRPETPLAVENGVGKPAAPARRLMSARERERGAVVV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.