NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F001679

Metagenome / Metatranscriptome Family F001679

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F001679
Family Type Metagenome / Metatranscriptome
Number of Sequences 653
Average Sequence Length 40 residues
Representative Sequence VWGMSWRQEAMKGVEDCDKPGEAVKRALIPGCPNYRALNP
Number of Associated Samples 445
Number of Associated Scaffolds 653

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 8.88 %
% of genes near scaffold ends (potentially truncated) 34.61 %
% of genes from short scaffolds (< 2000 bps) 96.78 %
Associated GOLD sequencing projects 436
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.263 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(36.600 % of family members)
Environment Ontology (ENVO) Unclassified
(27.412 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.176 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.41%    β-sheet: 0.00%    Coil/Unstructured: 70.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 653 Family Scaffolds
PF00483NTP_transferase 0.31
PF08762CRPV_capsid 0.15
PF00120Gln-synt_C 0.15
PF0563523S_rRNA_IVP 0.15
PF13432TPR_16 0.15
PF06186DUF992 0.15
PF02446Glyco_hydro_77 0.15
PF08281Sigma70_r4_2 0.15
PF00127Copper-bind 0.15
PF00700Flagellin_C 0.15
PF02910Succ_DH_flav_C 0.15
PF04542Sigma70_r2 0.15
PF16576HlyD_D23 0.15
PF02201SWIB 0.15
PF00027cNMP_binding 0.15
PF16363GDP_Man_Dehyd 0.15
PF00889EF_TS 0.15
PF00011HSP20 0.15
PF12623Hen1_L 0.15
PF04896AmoC 0.15
PF00012HSP70 0.15
PF00253Ribosomal_S14 0.15
PF14279HNH_5 0.15
PF13581HATPase_c_2 0.15
PF00620RhoGAP 0.15
PF13361UvrD_C 0.15
PF01159Ribosomal_L6e 0.15
PF02776TPP_enzyme_N 0.15
PF09861Lar_N 0.15
PF00158Sigma54_activat 0.15
PF07642BBP2 0.15
PF01781Ribosomal_L38e 0.15
PF01799Fer2_2 0.15
PF02082Rrf2 0.15
PF12551PHBC_N 0.15
PF00254FKBP_C 0.15
PF02416TatA_B_E 0.15
PF10431ClpB_D2-small 0.15
PF02874ATP-synt_ab_N 0.15
PF00171Aldedh 0.15
PF07517SecA_DEAD 0.15
PF02171Piwi 0.15
PF00112Peptidase_C1 0.15
PF05047L51_S25_CI-B8 0.15
PF08543Phos_pyr_kin 0.15

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 653 Family Scaffolds
COG5531DNA-binding SWIB/MDM2 domainChromatin structure and dynamics [B] 0.15
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.15
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.15
COG0199Ribosomal protein S14Translation, ribosomal structure and biogenesis [J] 0.15
COG0264Translation elongation factor EF-TsTranslation, ribosomal structure and biogenesis [J] 0.15
COG0351Hydroxymethylpyrimidine/phosphomethylpyrimidine kinaseCoenzyme transport and metabolism [H] 0.15
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.15
COG0524Sugar or nucleoside kinase, ribokinase familyCarbohydrate transport and metabolism [G] 0.15
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.15
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.15
COG0653Preprotein translocase subunit SecA (ATPase, RNA helicase)Intracellular trafficking, secretion, and vesicular transport [U] 0.15
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.15
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.15
COG1344Flagellin and related hook-associated protein FlgLCell motility [N] 0.15
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.15
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.15
COG16404-alpha-glucanotransferaseCarbohydrate transport and metabolism [G] 0.15
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.15
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 0.15
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.15
COG2163Ribosomal protein L14E/L6E/L27ETranslation, ribosomal structure and biogenesis [J] 0.15
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.15
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.15
COG2240Pyridoxal/pyridoxine/pyridoxamine kinaseCoenzyme transport and metabolism [H] 0.15
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.15
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.15
COG2870ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferaseCell wall/membrane/envelope biogenesis [M] 0.15
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.15
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.15


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.95 %
UnclassifiedrootN/A22.05 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2077657000|ZODLETONE_B1_GLDH0LQ01AET48All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis555Open in IMG/M
2077657000|ZODLETONE_B1_GLDH0LQ01B64DDAll Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis539Open in IMG/M
2077657000|ZODLETONE_B1_GLDH0LQ01BMN8BNot Available568Open in IMG/M
2077657000|ZODLETONE_B1_GLDH0LQ01BPG9QNot Available554Open in IMG/M
3300000336|thermBogB3DRAFT_101267Not Available506Open in IMG/M
3300004471|Ga0068965_1060341Not Available526Open in IMG/M
3300004629|Ga0008092_10026415All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005454|Ga0066687_10548845All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis686Open in IMG/M
3300006047|Ga0075024_100048784All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1765Open in IMG/M
3300006047|Ga0075024_100846373All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis516Open in IMG/M
3300006050|Ga0075028_100103898All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1453Open in IMG/M
3300006111|Ga0007848_1074600All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium632Open in IMG/M
3300006126|Ga0007855_1135236All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium509Open in IMG/M
3300006172|Ga0075018_10113527All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia1215Open in IMG/M
3300006175|Ga0070712_101836345All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes531Open in IMG/M
3300006355|Ga0075501_1059133Not Available1188Open in IMG/M
3300006355|Ga0075501_1074875Not Available776Open in IMG/M
3300006357|Ga0075502_1718915Not Available712Open in IMG/M
3300006364|Ga0075482_1032660All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300006373|Ga0075483_1025427All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300006373|Ga0075483_1050817All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes557Open in IMG/M
3300006373|Ga0075483_1070077Not Available2065Open in IMG/M
3300006378|Ga0075498_1114004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1041Open in IMG/M
3300006378|Ga0075498_1119908All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes563Open in IMG/M
3300006394|Ga0075492_1000784All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes679Open in IMG/M
3300006569|Ga0075500_129092All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300006638|Ga0075522_10354940All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300006691|Ga0031679_1006301All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300006712|Ga0031693_1009120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldalkalibacillus → Caldalkalibacillus thermarum → Caldalkalibacillus thermarum TA2.A12230Open in IMG/M
3300006791|Ga0066653_10434796Not Available670Open in IMG/M
3300006796|Ga0066665_10713069All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300006800|Ga0066660_10897733All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis721Open in IMG/M
3300006800|Ga0066660_10997658All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300006800|Ga0066660_11684638All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes505Open in IMG/M
3300006844|Ga0075428_100298394Not Available1732Open in IMG/M
3300006860|Ga0063829_1029223All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes720Open in IMG/M
3300006861|Ga0063777_1033349Not Available732Open in IMG/M
3300006861|Ga0063777_1038729All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium818Open in IMG/M
3300006865|Ga0073934_10421770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces815Open in IMG/M
3300006893|Ga0073928_11085047Not Available542Open in IMG/M
3300006904|Ga0075424_101140016All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis831Open in IMG/M
3300006934|Ga0080680_1052666Not Available1012Open in IMG/M
3300006934|Ga0080680_1068687Not Available579Open in IMG/M
3300006935|Ga0081246_1055890All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300006937|Ga0081243_1078196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5859Open in IMG/M
3300006937|Ga0081243_1093734All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis682Open in IMG/M
3300006938|Ga0081245_1040377All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300006938|Ga0081245_1068838All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes705Open in IMG/M
3300006939|Ga0081244_1035728All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes699Open in IMG/M
3300006939|Ga0081244_1072209All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis654Open in IMG/M
3300007519|Ga0105055_10011279All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae11049Open in IMG/M
3300007521|Ga0105044_10700087All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis825Open in IMG/M
3300007544|Ga0102861_1165923All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300007860|Ga0105735_1038738Not Available917Open in IMG/M
3300008559|Ga0103605_1004974Not Available817Open in IMG/M
3300008578|Ga0103649_100232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales664Open in IMG/M
3300008584|Ga0103655_100211All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300008590|Ga0103643_100990All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium505Open in IMG/M
3300008592|Ga0103654_100389All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300008655|Ga0103645_100823Not Available513Open in IMG/M
3300008661|Ga0103653_100662Not Available578Open in IMG/M
3300008661|Ga0103653_101125All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis509Open in IMG/M
3300008785|Ga0103638_1000444All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes878Open in IMG/M
3300009032|Ga0105048_10034414All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae7465Open in IMG/M
3300009032|Ga0105048_10132592Not Available3182Open in IMG/M
3300009038|Ga0099829_10469932Not Available1043Open in IMG/M
3300009075|Ga0105090_10301855All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes981Open in IMG/M
3300009088|Ga0099830_11362841All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis590Open in IMG/M
3300009089|Ga0099828_11212992All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium669Open in IMG/M
3300009095|Ga0079224_101429438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes982Open in IMG/M
3300009129|Ga0118728_1040138Not Available2561Open in IMG/M
3300009137|Ga0066709_102664786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia667Open in IMG/M
3300009143|Ga0099792_10687623All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300009199|Ga0103748_10016642All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1120Open in IMG/M
3300009199|Ga0103748_10042099All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis760Open in IMG/M
3300009203|Ga0103749_10021317All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis842Open in IMG/M
3300009203|Ga0103749_10025200All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes784Open in IMG/M
3300009206|Ga0103750_1022279Not Available725Open in IMG/M
3300009281|Ga0103744_10183314All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium505Open in IMG/M
3300009295|Ga0103747_10030266All Organisms → cellular organisms → Bacteria1275Open in IMG/M
3300009295|Ga0103747_10106864Not Available720Open in IMG/M
3300009348|Ga0103786_1002964All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300009348|Ga0103786_1002965All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300009349|Ga0103787_1007408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis aeruginosa → Microcystis aeruginosa PCC 7806757Open in IMG/M
3300009525|Ga0116220_10094633Not Available1263Open in IMG/M
3300009551|Ga0105238_11769875All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis650Open in IMG/M
3300009553|Ga0105249_12541979All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium584Open in IMG/M
3300009597|Ga0105259_1044052All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes984Open in IMG/M
3300009628|Ga0116125_1129500All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis689Open in IMG/M
3300009644|Ga0116121_1106434All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis880Open in IMG/M
3300009650|Ga0105857_1286260All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium503Open in IMG/M
3300009672|Ga0116215_1039048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2174Open in IMG/M
3300009683|Ga0116224_10543471All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium554Open in IMG/M
3300009691|Ga0114944_1244300Not Available727Open in IMG/M
3300009735|Ga0123377_1011285All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis609Open in IMG/M
3300009870|Ga0131092_10233767All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1870Open in IMG/M
3300010061|Ga0127462_167549All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300010063|Ga0127431_123394All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300010064|Ga0127433_103551All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300010065|Ga0127435_154191All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium579Open in IMG/M
3300010069|Ga0127467_105623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria832Open in IMG/M
3300010069|Ga0127467_127282All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis687Open in IMG/M
3300010072|Ga0127428_104256Not Available605Open in IMG/M
3300010072|Ga0127428_105392All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300010074|Ga0127439_131594Not Available1080Open in IMG/M
3300010074|Ga0127439_137785Not Available519Open in IMG/M
3300010075|Ga0127434_107165Not Available819Open in IMG/M
3300010075|Ga0127434_127246Not Available575Open in IMG/M
3300010075|Ga0127434_142987All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300010078|Ga0127487_138364All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium508Open in IMG/M
3300010082|Ga0127469_139641All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium685Open in IMG/M
3300010082|Ga0127469_156058All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis612Open in IMG/M
3300010083|Ga0127478_1096970All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes579Open in IMG/M
3300010086|Ga0127496_1035978All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300010086|Ga0127496_1088224All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis868Open in IMG/M
3300010088|Ga0127476_1024366Not Available531Open in IMG/M
3300010091|Ga0127485_1082356All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes953Open in IMG/M
3300010092|Ga0127468_1034014Not Available1542Open in IMG/M
3300010092|Ga0127468_1092847All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes937Open in IMG/M
3300010093|Ga0127490_1011657All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis503Open in IMG/M
3300010094|Ga0127480_1045295Not Available682Open in IMG/M
3300010096|Ga0127473_1018310All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis545Open in IMG/M
3300010096|Ga0127473_1056391All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis810Open in IMG/M
3300010096|Ga0127473_1096773Not Available611Open in IMG/M
3300010098|Ga0127463_1096185All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes570Open in IMG/M
3300010099|Ga0127450_1047678All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana660Open in IMG/M
3300010100|Ga0127440_1090159All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300010102|Ga0127453_1063132Not Available786Open in IMG/M
3300010102|Ga0127453_1067400All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300010104|Ga0127446_1023401All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes845Open in IMG/M
3300010105|Ga0127470_1052723Not Available521Open in IMG/M
3300010107|Ga0127494_1025049All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300010114|Ga0127460_1071534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces543Open in IMG/M
3300010116|Ga0127466_1117368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium895Open in IMG/M
3300010118|Ga0127465_1094332Not Available750Open in IMG/M
3300010120|Ga0127451_1075695Not Available642Open in IMG/M
3300010121|Ga0127438_1167832Not Available742Open in IMG/M
3300010123|Ga0127479_1044846All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300010123|Ga0127479_1170372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300010128|Ga0127486_1169601All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes670Open in IMG/M
3300010133|Ga0127459_1043580All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300010138|Ga0115595_1066387All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300010139|Ga0127464_1199140All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium516Open in IMG/M
3300010141|Ga0127499_1109273All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria615Open in IMG/M
3300010143|Ga0126322_1048539All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes571Open in IMG/M
3300010145|Ga0126321_1304690Not Available745Open in IMG/M
3300010343|Ga0074044_10654376All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300010349|Ga0116240_10625653All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300010358|Ga0126370_11925153All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium576Open in IMG/M
3300010359|Ga0126376_12158766All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes601Open in IMG/M
3300010375|Ga0105239_10966852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria978Open in IMG/M
3300010379|Ga0136449_104113644All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium541Open in IMG/M
3300010391|Ga0136847_10638593All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes705Open in IMG/M
3300010398|Ga0126383_11257636All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes830Open in IMG/M
3300010401|Ga0134121_10085398Not Available2630Open in IMG/M
3300010857|Ga0126354_1073897All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes775Open in IMG/M
3300010857|Ga0126354_1154118All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes590Open in IMG/M
3300010859|Ga0126352_1064175All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis715Open in IMG/M
3300010860|Ga0126351_1058635Not Available910Open in IMG/M
3300010861|Ga0126349_1269103All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300010861|Ga0126349_1306523All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes602Open in IMG/M
3300010869|Ga0126359_1122211All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes704Open in IMG/M
3300010872|Ga0136897_10836783All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1083Open in IMG/M
3300010896|Ga0138111_1097455All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana684Open in IMG/M
3300011031|Ga0138543_132078All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis505Open in IMG/M
3300011035|Ga0138542_140860All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis573Open in IMG/M
3300011041|Ga0138591_102318Not Available705Open in IMG/M
3300011049|Ga0138554_175603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria618Open in IMG/M
3300011051|Ga0138540_113619Not Available594Open in IMG/M
3300011057|Ga0138544_1093441All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium820Open in IMG/M
3300011059|Ga0138597_1035589All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis551Open in IMG/M
3300011067|Ga0138594_1005133All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis500Open in IMG/M
3300011071|Ga0138595_1016529All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300011073|Ga0138584_1041284All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis570Open in IMG/M
3300011075|Ga0138555_1085549All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia974Open in IMG/M
3300011078|Ga0138565_1124412All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis880Open in IMG/M
3300011080|Ga0138568_1025338All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes694Open in IMG/M
3300011080|Ga0138568_1202853All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium518Open in IMG/M
3300011081|Ga0138575_1038906All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes593Open in IMG/M
3300011084|Ga0138562_1208656All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis671Open in IMG/M
3300011090|Ga0138579_1117913All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300011120|Ga0150983_12090997All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium542Open in IMG/M
3300011120|Ga0150983_16341290All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes603Open in IMG/M
3300011271|Ga0137393_10285877All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis1403Open in IMG/M
3300011300|Ga0138364_1115216All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300011316|Ga0138399_1022635All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis927Open in IMG/M
3300011327|Ga0138398_1128297All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes675Open in IMG/M
3300011340|Ga0151652_12757345All Organisms → cellular organisms → Bacteria1962Open in IMG/M
3300011404|Ga0153951_1043170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldalkalibacillus → Caldalkalibacillus thermarum → Caldalkalibacillus thermarum TA2.A1785Open in IMG/M
3300012177|Ga0153943_1069076All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes743Open in IMG/M
3300012180|Ga0153974_1102914All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes649Open in IMG/M
3300012181|Ga0153922_1111032All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium628Open in IMG/M
3300012205|Ga0137362_10861935All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300012211|Ga0137377_10706357All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis943Open in IMG/M
3300012212|Ga0150985_100832320All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1031Open in IMG/M
3300012212|Ga0150985_101449137All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium767Open in IMG/M
3300012212|Ga0150985_105925484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia754Open in IMG/M
3300012212|Ga0150985_110492208All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300012212|Ga0150985_111164913All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1341Open in IMG/M
3300012224|Ga0134028_1246109All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300012355|Ga0137369_10377076All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis1029Open in IMG/M
3300012361|Ga0137360_11335517Not Available619Open in IMG/M
3300012363|Ga0137390_11125894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces734Open in IMG/M
3300012364|Ga0134027_1070952All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria611Open in IMG/M
3300012376|Ga0134032_1082832Not Available614Open in IMG/M
3300012385|Ga0134023_1249935All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis545Open in IMG/M
3300012386|Ga0134046_1055460All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300012389|Ga0134040_1202060All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter towneri → Acinetobacter towneri DSM 14962 = CIP 107472567Open in IMG/M
3300012390|Ga0134054_1278843All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes557Open in IMG/M
3300012404|Ga0134024_1373333All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Thermotoga → unclassified Thermotoga → Thermotoga sp. TBYP3.1.4.1709Open in IMG/M
3300012405|Ga0134041_1241093All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes683Open in IMG/M
3300012407|Ga0134050_1296255All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes501Open in IMG/M
3300012469|Ga0150984_105206171All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium551Open in IMG/M
3300012469|Ga0150984_105213739All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis1163Open in IMG/M
3300012469|Ga0150984_106269700All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes640Open in IMG/M
3300012469|Ga0150984_109107083All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium535Open in IMG/M
3300012469|Ga0150984_120093440All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis553Open in IMG/M
3300012469|Ga0150984_120293926All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300012683|Ga0137398_11083146All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012693|Ga0157573_1042948All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis551Open in IMG/M
3300012737|Ga0157525_118557All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012768|Ga0138276_1001844All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300012770|Ga0138291_1044509All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300012775|Ga0138280_1215013All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes639Open in IMG/M
3300012776|Ga0138275_1056934Not Available848Open in IMG/M
3300012907|Ga0157283_10145058All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes693Open in IMG/M
3300012975|Ga0134110_10527441All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium540Open in IMG/M
(restricted) 3300013127|Ga0172365_10167384Not Available1362Open in IMG/M
3300013295|Ga0170791_12374390All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis523Open in IMG/M
3300013766|Ga0120181_1150167Not Available505Open in IMG/M
3300014157|Ga0134078_10508020All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes561Open in IMG/M
3300014164|Ga0181532_10142124All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1452Open in IMG/M
3300014165|Ga0181523_10055143All Organisms → cellular organisms → Bacteria2454Open in IMG/M
3300014201|Ga0181537_10170690All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1494Open in IMG/M
3300014298|Ga0075341_1106131Not Available554Open in IMG/M
3300014655|Ga0181516_10577798Not Available579Open in IMG/M
3300014838|Ga0182030_10385994All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300014879|Ga0180062_1098277All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia665Open in IMG/M
3300015201|Ga0173478_10444106All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300015245|Ga0137409_10544719All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes987Open in IMG/M
3300015360|Ga0163144_10595569Not Available1199Open in IMG/M
3300015372|Ga0132256_103002809All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes567Open in IMG/M
3300016341|Ga0182035_10718435Not Available872Open in IMG/M
3300016683|Ga0180042_154712All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300016700|Ga0181513_1181727Not Available683Open in IMG/M
3300016705|Ga0181507_1036149Not Available687Open in IMG/M
3300016750|Ga0181505_10270608All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300016750|Ga0181505_10357712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria557Open in IMG/M
3300016750|Ga0181505_10667323Not Available565Open in IMG/M
3300016750|Ga0181505_10902160All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis563Open in IMG/M
3300017947|Ga0187785_10610461All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes561Open in IMG/M
3300017975|Ga0187782_10396526All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1048Open in IMG/M
3300017994|Ga0187822_10323317All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes550Open in IMG/M
3300018032|Ga0187788_10369429All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes596Open in IMG/M
3300018043|Ga0187887_10044184Not Available2756Open in IMG/M
3300018058|Ga0187766_10906760All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300018060|Ga0187765_10499331All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis769Open in IMG/M
3300018060|Ga0187765_11182025All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium535Open in IMG/M
3300018090|Ga0187770_10387568All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1097Open in IMG/M
3300019207|Ga0180034_1085891All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300019208|Ga0180110_1148765All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1666Open in IMG/M
3300019228|Ga0180119_1239937Not Available827Open in IMG/M
3300019238|Ga0180112_1357948All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300019240|Ga0181510_1334341All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes582Open in IMG/M
3300019256|Ga0181508_1082861All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes768Open in IMG/M
3300019258|Ga0181504_1111217All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300019258|Ga0181504_1439546Not Available1491Open in IMG/M
3300019259|Ga0184646_1257897All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium608Open in IMG/M
3300019263|Ga0184647_1397902All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes928Open in IMG/M
3300019264|Ga0187796_1385114All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis823Open in IMG/M
3300019265|Ga0187792_1703423All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes598Open in IMG/M
3300019268|Ga0181514_1021359All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300019273|Ga0187794_1063742All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria758Open in IMG/M
3300020063|Ga0180118_1289203All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium745Open in IMG/M
3300020068|Ga0184649_1135580Not Available506Open in IMG/M
3300020076|Ga0206355_1430392All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes612Open in IMG/M
3300020080|Ga0206350_10781044All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300020082|Ga0206353_11970453Not Available514Open in IMG/M
3300020157|Ga0194049_1007620All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium2868Open in IMG/M
3300020192|Ga0163147_10035741Not Available4055Open in IMG/M
3300020195|Ga0163150_10376427All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium663Open in IMG/M
3300020200|Ga0194121_10023127Not Available6196Open in IMG/M
3300021151|Ga0179584_1089650All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium543Open in IMG/M
3300021170|Ga0210400_11158194Not Available624Open in IMG/M
3300021258|Ga0210345_145379All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes599Open in IMG/M
3300021266|Ga0210348_114120All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes767Open in IMG/M
3300021266|Ga0210348_123734All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes628Open in IMG/M
3300021269|Ga0210356_143823All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium554Open in IMG/M
3300021277|Ga0210352_131892All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300021299|Ga0210302_1116007All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300021304|Ga0210331_1050698All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter towneri → Acinetobacter towneri DSM 14962 = CIP 107472606Open in IMG/M
3300021313|Ga0210333_1342878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces701Open in IMG/M
3300021314|Ga0210370_1171404All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia673Open in IMG/M
3300021362|Ga0213882_10090233All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300021388|Ga0213875_10285989All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Thermotoga → unclassified Thermotoga → Thermotoga sp. TBYP3.1.4.1779Open in IMG/M
3300021406|Ga0210386_10099173Not Available2386Open in IMG/M
3300021560|Ga0126371_11561626All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes787Open in IMG/M
3300021844|Ga0210361_141684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria816Open in IMG/M
3300021844|Ga0210361_170530All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium992Open in IMG/M
3300021852|Ga0210317_1138093All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300021860|Ga0213851_1252722All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium535Open in IMG/M
3300021860|Ga0213851_1378393All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium783Open in IMG/M
3300021947|Ga0213856_1263329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales952Open in IMG/M
3300021947|Ga0213856_1288405All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium632Open in IMG/M
3300022166|Ga0213932_1063819All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes545Open in IMG/M
3300022498|Ga0242644_1007121Not Available933Open in IMG/M
3300022498|Ga0242644_1012451Not Available781Open in IMG/M
3300022498|Ga0242644_1012566All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia778Open in IMG/M
3300022498|Ga0242644_1037565All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300022499|Ga0242641_1010720All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300022499|Ga0242641_1010841All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes812Open in IMG/M
3300022499|Ga0242641_1012801All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis774Open in IMG/M
3300022499|Ga0242641_1030505All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300022499|Ga0242641_1046651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria515Open in IMG/M
3300022500|Ga0242643_101435All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300022500|Ga0242643_105575All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis819Open in IMG/M
3300022500|Ga0242643_113620All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium613Open in IMG/M
3300022501|Ga0242645_1006233All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300022501|Ga0242645_1023244All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300022501|Ga0242645_1030644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5511Open in IMG/M
3300022502|Ga0242646_1029549All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes557Open in IMG/M
3300022503|Ga0242650_1007353Not Available766Open in IMG/M
3300022503|Ga0242650_1014705All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300022504|Ga0242642_1001500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2222Open in IMG/M
3300022504|Ga0242642_1003554Not Available1663Open in IMG/M
3300022504|Ga0242642_1008403All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1230Open in IMG/M
3300022504|Ga0242642_1009375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1182Open in IMG/M
3300022504|Ga0242642_1010480Not Available1134Open in IMG/M
3300022504|Ga0242642_1010497All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300022504|Ga0242642_1019224Not Available918Open in IMG/M
3300022504|Ga0242642_1027987All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes802Open in IMG/M
3300022504|Ga0242642_1041766All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300022504|Ga0242642_1053825Not Available632Open in IMG/M
3300022504|Ga0242642_1057170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales619Open in IMG/M
3300022504|Ga0242642_1076252All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300022504|Ga0242642_1080279All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes548Open in IMG/M
3300022504|Ga0242642_1099798All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis507Open in IMG/M
3300022504|Ga0242642_1103039All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300022505|Ga0242647_1001559All Organisms → cellular organisms → Eukaryota1530Open in IMG/M
3300022505|Ga0242647_1008786Not Available871Open in IMG/M
3300022505|Ga0242647_1022034Not Available645Open in IMG/M
3300022506|Ga0242648_1007762Not Available1143Open in IMG/M
3300022506|Ga0242648_1037110All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis700Open in IMG/M
3300022506|Ga0242648_1045376All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300022507|Ga0222729_1001645All Organisms → cellular organisms → Bacteria1743Open in IMG/M
3300022507|Ga0222729_1005706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1173Open in IMG/M
3300022507|Ga0222729_1007192Not Available1087Open in IMG/M
3300022507|Ga0222729_1036886All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis639Open in IMG/M
3300022507|Ga0222729_1053898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium562Open in IMG/M
3300022507|Ga0222729_1055802Not Available556Open in IMG/M
3300022508|Ga0222728_1027806All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes858Open in IMG/M
3300022508|Ga0222728_1031698All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300022508|Ga0222728_1046279All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300022508|Ga0222728_1057450All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis667Open in IMG/M
3300022508|Ga0222728_1084951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria580Open in IMG/M
3300022509|Ga0242649_1006574All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300022509|Ga0242649_1006869All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1123Open in IMG/M
3300022509|Ga0242649_1010992All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis964Open in IMG/M
3300022509|Ga0242649_1027945All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300022509|Ga0242649_1033045All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300022509|Ga0242649_1054534All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes570Open in IMG/M
3300022509|Ga0242649_1056181All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300022509|Ga0242649_1072410All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes519Open in IMG/M
3300022509|Ga0242649_1072953All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300022510|Ga0242652_1033066All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes602Open in IMG/M
3300022511|Ga0242651_1020120Not Available694Open in IMG/M
3300022511|Ga0242651_1022271All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis671Open in IMG/M
3300022511|Ga0242651_1047929Not Available522Open in IMG/M
3300022513|Ga0242667_1039547All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis568Open in IMG/M
3300022522|Ga0242659_1027032All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium919Open in IMG/M
3300022522|Ga0242659_1027857All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes908Open in IMG/M
3300022522|Ga0242659_1039505Not Available802Open in IMG/M
3300022522|Ga0242659_1075719All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes634Open in IMG/M
3300022523|Ga0242663_1003267All Organisms → cellular organisms → Bacteria1803Open in IMG/M
3300022523|Ga0242663_1063193All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis677Open in IMG/M
3300022523|Ga0242663_1077996All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300022523|Ga0242663_1087354All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium605Open in IMG/M
3300022527|Ga0242664_1082073All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes638Open in IMG/M
3300022528|Ga0242669_1111988All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria540Open in IMG/M
3300022529|Ga0242668_1097600Not Available592Open in IMG/M
3300022530|Ga0242658_1021227All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis1174Open in IMG/M
3300022530|Ga0242658_1136657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria621Open in IMG/M
3300022530|Ga0242658_1149802Not Available601Open in IMG/M
3300022530|Ga0242658_1178148All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae565Open in IMG/M
3300022531|Ga0242660_1048258Not Available920Open in IMG/M
3300022531|Ga0242660_1060109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae852Open in IMG/M
3300022531|Ga0242660_1105043Not Available695Open in IMG/M
3300022531|Ga0242660_1211964Not Available537Open in IMG/M
3300022532|Ga0242655_10057460All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300022532|Ga0242655_10189502All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes624Open in IMG/M
3300022532|Ga0242655_10229536Not Available579Open in IMG/M
3300022533|Ga0242662_10213192All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium613Open in IMG/M
3300022708|Ga0242670_1014916All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300022708|Ga0242670_1018095All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium817Open in IMG/M
3300022708|Ga0242670_1029265All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria703Open in IMG/M
3300022711|Ga0242674_1051960All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria566Open in IMG/M
3300022712|Ga0242653_1012584All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300022713|Ga0242677_1010498All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1006Open in IMG/M
3300022713|Ga0242677_1062545All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae570Open in IMG/M
3300022716|Ga0242673_1030913All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes821Open in IMG/M
3300022716|Ga0242673_1031175All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300022716|Ga0242673_1061259All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300022717|Ga0242661_1008797Not Available1407Open in IMG/M
3300022717|Ga0242661_1027066All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300022717|Ga0242661_1027129All Organisms → cellular organisms → Bacteria → Proteobacteria965Open in IMG/M
3300022717|Ga0242661_1034981All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300022717|Ga0242661_1055095All Organisms → cellular organisms → Bacteria → Acidobacteria751Open in IMG/M
3300022717|Ga0242661_1059312Not Available732Open in IMG/M
3300022717|Ga0242661_1085269All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300022717|Ga0242661_1152494Not Available519Open in IMG/M
3300022717|Ga0242661_1157426All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis513Open in IMG/M
3300022718|Ga0242675_1004307All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1484Open in IMG/M
3300022718|Ga0242675_1020447Not Available924Open in IMG/M
3300022720|Ga0242672_1025079All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia861Open in IMG/M
3300022720|Ga0242672_1037482All Organisms → cellular organisms → Bacteria → Proteobacteria765Open in IMG/M
3300022722|Ga0242657_1154329All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis607Open in IMG/M
3300022722|Ga0242657_1228304All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes525Open in IMG/M
3300022724|Ga0242665_10066003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1002Open in IMG/M
3300022724|Ga0242665_10357588Not Available524Open in IMG/M
3300022726|Ga0242654_10152300All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium773Open in IMG/M
3300022726|Ga0242654_10260334All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis625Open in IMG/M
3300022726|Ga0242654_10268856All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300022726|Ga0242654_10272962All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300022726|Ga0242654_10275595All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300022726|Ga0242654_10290467All Organisms → cellular organisms → Bacteria598Open in IMG/M
(restricted) 3300023208|Ga0233424_10004166All Organisms → cellular organisms → Bacteria8941Open in IMG/M
3300023544|Ga0247542_102613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria670Open in IMG/M
3300023656|Ga0247547_102196All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis611Open in IMG/M
3300023706|Ga0232123_1053410All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis805Open in IMG/M
3300024532|Ga0256352_1043156Not Available808Open in IMG/M
3300025310|Ga0209172_10116852All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1505Open in IMG/M
3300025314|Ga0209323_10713139Not Available544Open in IMG/M
3300025848|Ga0208005_1172661Not Available673Open in IMG/M
3300025924|Ga0207694_10001965All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae17007Open in IMG/M
3300025972|Ga0207668_11399131All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300026221|Ga0209848_1018319All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia1371Open in IMG/M
3300026542|Ga0209805_1152207All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1061Open in IMG/M
3300026542|Ga0209805_1183150Not Available924Open in IMG/M
3300026557|Ga0179587_10813407All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300026565|Ga0256311_1028430All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300027039|Ga0207855_1032269All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes708Open in IMG/M
3300027568|Ga0208042_1008964Not Available2685Open in IMG/M
3300027680|Ga0207826_1225837All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes501Open in IMG/M
3300027681|Ga0208991_1045149All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1331Open in IMG/M
3300027848|Ga0209390_10010185All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes11070Open in IMG/M
3300027850|Ga0209591_10433365All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis895Open in IMG/M
3300027986|Ga0209168_10601909All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes526Open in IMG/M
3300028077|Ga0256323_1026158Not Available865Open in IMG/M
3300028108|Ga0256305_1011313All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2199Open in IMG/M
3300028592|Ga0247822_10284675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1259Open in IMG/M
3300028668|Ga0257140_1028917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldalkalibacillus → Caldalkalibacillus thermarum → Caldalkalibacillus thermarum TA2.A11046Open in IMG/M
(restricted) 3300029268|Ga0247842_10122700Not Available1549Open in IMG/M
3300029659|Ga0206094_110017All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria768Open in IMG/M
3300030006|Ga0299907_10983787Not Available621Open in IMG/M
3300030058|Ga0302179_10325704All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis677Open in IMG/M
3300030525|Ga0210273_1150696All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfonauticaceae → Desulfonauticus → unclassified Desulfonauticus → Desulfonauticus sp. 38_4375522Open in IMG/M
3300030528|Ga0210277_10377277All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia713Open in IMG/M
3300030528|Ga0210277_10525017All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300030532|Ga0210290_1200601All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis663Open in IMG/M
3300030537|Ga0247642_1024526Not Available608Open in IMG/M
3300030540|Ga0247649_1050379Not Available597Open in IMG/M
3300030540|Ga0247649_1093913Not Available526Open in IMG/M
3300030543|Ga0210289_1320294All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes603Open in IMG/M
3300030545|Ga0210271_10886848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF51106Open in IMG/M
3300030554|Ga0247640_1107789All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea652Open in IMG/M
3300030564|Ga0210256_10326686All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis650Open in IMG/M
3300030569|Ga0247628_1124306All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes686Open in IMG/M
3300030570|Ga0247647_1169604Not Available603Open in IMG/M
3300030584|Ga0247658_1142416Not Available520Open in IMG/M
3300030589|Ga0210255_10183659Not Available1327Open in IMG/M
3300030596|Ga0210278_1048350All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300030598|Ga0210287_1090654All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia719Open in IMG/M
3300030600|Ga0247659_1226950Not Available507Open in IMG/M
3300030602|Ga0210254_10490860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Anoxybacillus → unclassified Anoxybacillus → Anoxybacillus sp. BCO11246Open in IMG/M
3300030604|Ga0247637_1200433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldalkalibacillus → Caldalkalibacillus thermarum → Caldalkalibacillus thermarum TA2.A1521Open in IMG/M
3300030605|Ga0210265_1130650All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes556Open in IMG/M
3300030607|Ga0247615_10374166All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300030624|Ga0210251_11080031All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis502Open in IMG/M
3300030629|Ga0210268_1221766All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium614Open in IMG/M
3300030633|Ga0247623_10028535All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300030633|Ga0247623_10325633Not Available514Open in IMG/M
3300030635|Ga0247627_10184637All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes629Open in IMG/M
3300030684|Ga0247617_1149919Not Available504Open in IMG/M
3300030740|Ga0265460_10960297Not Available781Open in IMG/M
3300030740|Ga0265460_12966437All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium510Open in IMG/M
3300030741|Ga0265459_10979506All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes883Open in IMG/M
3300030741|Ga0265459_13255951All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes568Open in IMG/M
3300030751|Ga0102764_1942093All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300030758|Ga0138305_1559167All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Tricladiaceae → Cudoniella → Cudoniella acicularis1176Open in IMG/M
3300030760|Ga0265762_1068170All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis742Open in IMG/M
3300030763|Ga0265763_1031767All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300030774|Ga0074007_10152543All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300030777|Ga0075402_10137217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1129Open in IMG/M
3300030777|Ga0075402_12319934All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium517Open in IMG/M
3300030777|Ga0075402_12478280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria578Open in IMG/M
3300030778|Ga0075398_10053193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces677Open in IMG/M
3300030778|Ga0075398_12218360All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium687Open in IMG/M
3300030782|Ga0102754_1059889All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1035Open in IMG/M
3300030783|Ga0102752_1030336All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria667Open in IMG/M
3300030784|Ga0102758_10088004Not Available777Open in IMG/M
3300030790|Ga0138304_1026964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldalkalibacillus → Caldalkalibacillus thermarum → Caldalkalibacillus thermarum TA2.A11128Open in IMG/M
3300030829|Ga0308203_1035762All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300030830|Ga0308205_1021096Not Available748Open in IMG/M
3300030831|Ga0308152_112072Not Available553Open in IMG/M
3300030839|Ga0073999_10135108All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium800Open in IMG/M
3300030843|Ga0075392_10065822All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes666Open in IMG/M
3300030845|Ga0075397_10054530Not Available695Open in IMG/M
3300030848|Ga0075388_10092474All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes954Open in IMG/M
3300030849|Ga0075393_10085399All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1084Open in IMG/M
3300030852|Ga0075389_10068142All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium P201973Open in IMG/M
3300030854|Ga0075385_10049413All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes540Open in IMG/M
3300030855|Ga0075374_10077066All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium666Open in IMG/M
3300030855|Ga0075374_10091104All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfonauticaceae → Desulfonauticus → unclassified Desulfonauticus → Desulfonauticus sp. 38_4375686Open in IMG/M
3300030855|Ga0075374_10129124Not Available749Open in IMG/M
3300030858|Ga0102759_1027780All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis574Open in IMG/M
3300030858|Ga0102759_1973515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5539Open in IMG/M
3300030858|Ga0102759_1976026All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes876Open in IMG/M
3300030867|Ga0102749_1002102All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana793Open in IMG/M
3300030867|Ga0102749_1009694Not Available1099Open in IMG/M
3300030867|Ga0102749_1027453All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium533Open in IMG/M
3300030880|Ga0265776_107977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5594Open in IMG/M
3300030880|Ga0265776_110210All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes554Open in IMG/M
3300030886|Ga0265772_101753All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis810Open in IMG/M
3300030904|Ga0308198_1099469All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium509Open in IMG/M
3300030917|Ga0075382_10041826All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis643Open in IMG/M
3300030917|Ga0075382_10052342Not Available748Open in IMG/M
3300030917|Ga0075382_10106568All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium847Open in IMG/M
3300030917|Ga0075382_10120044All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes642Open in IMG/M
3300030920|Ga0102762_1045026All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis692Open in IMG/M
3300030923|Ga0138296_1792429All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300030936|Ga0138306_1442349All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300030936|Ga0138306_1597972Not Available850Open in IMG/M
3300030939|Ga0138303_1111600All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium553Open in IMG/M
3300030939|Ga0138303_1280555Not Available958Open in IMG/M
3300030939|Ga0138303_1409319All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300030939|Ga0138303_1467501All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes920Open in IMG/M
3300030939|Ga0138303_1479343Not Available809Open in IMG/M
3300030942|Ga0247549_100385Not Available1219Open in IMG/M
3300030945|Ga0075373_11662534Not Available700Open in IMG/M
3300030947|Ga0075390_10022289All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes707Open in IMG/M
3300030950|Ga0074034_10052725All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes969Open in IMG/M
3300030950|Ga0074034_10053662All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis729Open in IMG/M
3300030960|Ga0102745_1029909Not Available680Open in IMG/M
3300030960|Ga0102745_1045491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Oribacterium → unclassified Oribacterium → Oribacterium sp. oral taxon 078 → Oribacterium sp. oral taxon 078 str. F0262992Open in IMG/M
3300030960|Ga0102745_1800529All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300030963|Ga0265768_101787All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1046Open in IMG/M
3300030969|Ga0075394_10152832All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300030970|Ga0075381_10104898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5791Open in IMG/M
3300030970|Ga0075381_10121038Not Available755Open in IMG/M
3300030970|Ga0075381_10156744Not Available944Open in IMG/M
3300030973|Ga0075395_10028516All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium762Open in IMG/M
3300030973|Ga0075395_10047572All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300030974|Ga0075371_10023734All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes501Open in IMG/M
3300030975|Ga0099845_1045685All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes547Open in IMG/M
3300030981|Ga0102770_10027533All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300030981|Ga0102770_10028148All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis779Open in IMG/M
3300030982|Ga0265748_100740All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana1080Open in IMG/M
3300030986|Ga0308154_105898All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300030990|Ga0308178_1033635All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02888Open in IMG/M
3300030997|Ga0073997_10106298All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300031011|Ga0265774_103575All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300031013|Ga0102753_1019658Not Available1864Open in IMG/M
3300031015|Ga0138298_1373153Not Available851Open in IMG/M
3300031015|Ga0138298_1734506All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300031016|Ga0265732_103868All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300031018|Ga0265773_1010045All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium792Open in IMG/M
3300031021|Ga0102765_10141037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1032Open in IMG/M
3300031022|Ga0138301_1130523All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium539Open in IMG/M
3300031022|Ga0138301_1169884All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes759Open in IMG/M
3300031022|Ga0138301_1646917All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis541Open in IMG/M
3300031023|Ga0073998_10086681All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis1183Open in IMG/M
3300031039|Ga0102760_10007067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300031041|Ga0265755_108154All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis634Open in IMG/M
3300031042|Ga0265749_104086Not Available545Open in IMG/M
3300031047|Ga0073995_10058613All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia805Open in IMG/M
3300031047|Ga0073995_10079865All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300031053|Ga0074018_1788077All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes546Open in IMG/M
3300031054|Ga0102746_10036210All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300031054|Ga0102746_10038288All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1296Open in IMG/M
3300031054|Ga0102746_10069672All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes561Open in IMG/M
3300031054|Ga0102746_10072779All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1320Open in IMG/M
3300031054|Ga0102746_10088632All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes716Open in IMG/M
3300031055|Ga0102751_1395022Not Available565Open in IMG/M
3300031057|Ga0170834_103779642All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis510Open in IMG/M
3300031057|Ga0170834_108260792All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium699Open in IMG/M
3300031082|Ga0308192_1032658All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana727Open in IMG/M
3300031089|Ga0102748_10063411All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300031089|Ga0102748_10103775All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda527Open in IMG/M
3300031091|Ga0308201_10259425All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium602Open in IMG/M
3300031094|Ga0308199_1109153Not Available618Open in IMG/M
3300031096|Ga0308193_1063088All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031097|Ga0308188_1026893Not Available578Open in IMG/M
3300031114|Ga0308187_10163920Not Available752Open in IMG/M
3300031122|Ga0170822_10389666All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Russulales → Auriscalpiaceae → Artomyces → Artomyces pyxidatus1075Open in IMG/M
3300031122|Ga0170822_13428200All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis741Open in IMG/M
3300031123|Ga0308195_1046149All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031124|Ga0308151_1025355All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium633Open in IMG/M
3300031125|Ga0308182_1007395All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes799Open in IMG/M
3300031231|Ga0170824_100872420All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis535Open in IMG/M
3300031231|Ga0170824_101707205All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes625Open in IMG/M
3300031231|Ga0170824_102753273All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium580Open in IMG/M
3300031231|Ga0170824_114876895All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium788Open in IMG/M
3300031231|Ga0170824_125717903All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300031424|Ga0308179_1003431All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1264Open in IMG/M
3300031424|Ga0308179_1015726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces789Open in IMG/M
3300031446|Ga0170820_13114062All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes725Open in IMG/M
3300031446|Ga0170820_13332626All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300031446|Ga0170820_14995991All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria555Open in IMG/M
3300031446|Ga0170820_16500096All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium568Open in IMG/M
3300031446|Ga0170820_16600355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5713Open in IMG/M
3300031469|Ga0170819_10318632All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium530Open in IMG/M
3300031469|Ga0170819_16154974All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis689Open in IMG/M
3300031469|Ga0170819_17573572All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300031469|Ga0170819_17984762All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis552Open in IMG/M
3300031474|Ga0170818_103481289All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300031474|Ga0170818_103588779All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes528Open in IMG/M
3300031474|Ga0170818_105692137All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes579Open in IMG/M
3300031474|Ga0170818_106290922All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis572Open in IMG/M
3300031474|Ga0170818_106583517Not Available855Open in IMG/M
3300031484|Ga0314822_110869All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium558Open in IMG/M
3300031499|Ga0314818_111414Not Available542Open in IMG/M
3300031573|Ga0310915_10378025Not Available1005Open in IMG/M
3300031573|Ga0310915_10706435All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis712Open in IMG/M
3300031890|Ga0306925_10788359All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium987Open in IMG/M
3300031891|Ga0316039_117513All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana526Open in IMG/M
3300031910|Ga0306923_11143585Not Available836Open in IMG/M
3300031910|Ga0306923_11778386All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes634Open in IMG/M
3300031912|Ga0306921_10967346Not Available962Open in IMG/M
3300031954|Ga0306926_11342489All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium833Open in IMG/M
3300031955|Ga0316035_110349All Organisms → cellular organisms → Bacteria → Proteobacteria697Open in IMG/M
3300031956|Ga0316032_106499All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis579Open in IMG/M
3300031965|Ga0326597_10911263Not Available898Open in IMG/M
3300032001|Ga0306922_11901328All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes583Open in IMG/M
3300032027|Ga0247536_103049Not Available703Open in IMG/M
3300032035|Ga0310911_10843295Not Available529Open in IMG/M
3300032051|Ga0318532_10182147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Oribacterium → unclassified Oribacterium → Oribacterium sp. oral taxon 078 → Oribacterium sp. oral taxon 078 str. F0262746Open in IMG/M
3300032059|Ga0318533_10634404All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300032059|Ga0318533_10697887Not Available745Open in IMG/M
3300032120|Ga0316053_103095Not Available972Open in IMG/M
3300032160|Ga0311301_10829875Not Available1262Open in IMG/M
3300032180|Ga0307471_101109372All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis957Open in IMG/M
3300032261|Ga0306920_100175621Not Available3195Open in IMG/M
3300032261|Ga0306920_101679432All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300032261|Ga0306920_101811850All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium861Open in IMG/M
3300032261|Ga0306920_102075310All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes794Open in IMG/M
3300032515|Ga0348332_10133774All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea1414Open in IMG/M
3300032515|Ga0348332_10622449All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia1155Open in IMG/M
3300032515|Ga0348332_10750992All Organisms → cellular organisms → Bacteria → Acidobacteria1101Open in IMG/M
3300032515|Ga0348332_13520631All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes706Open in IMG/M
3300032515|Ga0348332_14135920All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1990Open in IMG/M
3300032756|Ga0315742_13039538All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium541Open in IMG/M
3300032896|Ga0335075_11589889Not Available538Open in IMG/M
3300034676|Ga0314801_185118All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium524Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil36.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil9.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.28%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.13%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.68%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.14%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.14%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.84%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.68%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.23%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.23%
Wastewater SludgeEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge1.23%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.07%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.07%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.07%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.77%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.77%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.77%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.77%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.61%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.61%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.61%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.61%
Sulfur Spring Sediment And CrustEnvironmental → Aquatic → Thermal Springs → Warm (34-42C) → Sediment → Sulfur Spring Sediment And Crust0.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.61%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.61%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.46%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.46%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.46%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.46%
Microbial MatsEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats0.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.31%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.31%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.31%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.31%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.31%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.31%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.15%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.15%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.15%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.15%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.15%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.15%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.15%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.15%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland0.15%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.15%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.15%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.15%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.15%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents0.15%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.15%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.15%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.15%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil0.15%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.15%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.15%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Soil0.15%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.15%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.15%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.15%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.15%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.15%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.15%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.15%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.15%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.15%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.15%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.15%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.15%
Wetland SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil0.15%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2077657000Sulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B1EnvironmentalOpen in IMG/M
3300000336Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Thermokarst Bog cDNA B3 MetatranscriptomeEnvironmentalOpen in IMG/M
3300004471Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006111Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08EnvironmentalOpen in IMG/M
3300006126Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006364Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006373Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006569Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006691Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP138 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006712Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP1602 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006860Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006861Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006934Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A1 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300006935Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A10 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300006937Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300006938Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A001 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300006939Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007519Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03EnvironmentalOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300008559Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-06-47EnvironmentalOpen in IMG/M
3300008578Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Powermax_1aHost-AssociatedOpen in IMG/M
3300008584Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Control_2aHost-AssociatedOpen in IMG/M
3300008590Microbial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Powermax_2aHost-AssociatedOpen in IMG/M
3300008592Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Control_1bHost-AssociatedOpen in IMG/M
3300008655Microbial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Control_1aHost-AssociatedOpen in IMG/M
3300008661Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Control_1aHost-AssociatedOpen in IMG/M
3300008785Microbial communities from wetland soil in Czech Republic - R1_cDNAEnvironmentalOpen in IMG/M
3300009032Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300009129Combined Assembly of Gp0139513, Gp0139514EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009199Microbial communities of wastewater sludge from Singapore - Sludge7_b2_FebruaryEnvironmentalOpen in IMG/M
3300009203Microbial communities of wastewater sludge from Singapore - Sludge9_b2_FebruaryEnvironmentalOpen in IMG/M
3300009206Microbial communities of wastewater sludge from Singapore - Sludge11_b2_FebruaryEnvironmentalOpen in IMG/M
3300009281Microbial communities of wastewater sludge from Singapore - Sludge_b1_OctoberEnvironmentalOpen in IMG/M
3300009295Microbial communities of wastewater sludge from Singapore - Sludge5_b2_FebruaryEnvironmentalOpen in IMG/M
3300009348Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone2_total_RNAEnvironmentalOpen in IMG/M
3300009349Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone2_mRNAEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009650Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009691Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010061Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010063Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010064Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010065Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010069Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010072Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010074Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010075Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010078Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010082Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010083Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010086Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010088Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010091Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010092Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010093Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010094Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010096Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010098Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010099Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010100Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010102Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010104Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010105Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010107Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010114Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010116Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010118Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010120Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010121Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010123Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010128Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010133Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010138Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010139Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010141Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010143Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010349AD_HKTAcaEngineeredOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010857Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010872Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 5)EnvironmentalOpen in IMG/M
3300010896Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011031Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 24 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011035Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 23 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011041Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 17 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011049Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 35 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011051Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011057Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011059Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011067Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011071Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011073Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011075Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011078Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011080Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011081Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011084Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011090Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011300Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 DCM_A metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011316Marine microbial communities from the Southern Atlantic ocean - KN S19 Bottom_A metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011327Marine microbial communities from the Southern Atlantic ocean - KN S19 NADW_A metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300011404Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ035 MetaGHost-AssociatedOpen in IMG/M
3300012177Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaGHost-AssociatedOpen in IMG/M
3300012180Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaGHost-AssociatedOpen in IMG/M
3300012181Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaGHost-AssociatedOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012224Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012376Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012385Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012386Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012389Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012404Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012405Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012693Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES075 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012737Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES003 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012768Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012770Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012775Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012776Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014298Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014879Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10DEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016683Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES128 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016700Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019207Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019208Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019228Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019264Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019265Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019273Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020068Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020157Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25mEnvironmentalOpen in IMG/M
3300020192Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1EnvironmentalOpen in IMG/M
3300020195Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IBEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300021151Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021258Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.445 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021266Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.458 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021269Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.499 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021277Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.487 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021299Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021304Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.300 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021313Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.304 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021314Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.671 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021844Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.595 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021852Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.23 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021947Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022166Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022498Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022499Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022500Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022501Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022502Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022503Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022505Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022506Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022508Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022509Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022511Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022513Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022527Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023208 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MGEnvironmentalOpen in IMG/M
3300023544Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023656Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023706Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024532Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026221Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026565Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027039Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027848Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027850Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028077Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028108Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028668Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_120m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029268 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19mEnvironmentalOpen in IMG/M
3300029659Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030525Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO037SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030532Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030537Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030540Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030554Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030569Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030570Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030584Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030600Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030604Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030605Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE042SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030607Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030629Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030633Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030635Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030684Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030751Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030758Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030774Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030782Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 4B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030783Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030784Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030790Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030830Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030831Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030839Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030843Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030845Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030849Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030852Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030854Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030858Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030867Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030880Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030886Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030917Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030920Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030936Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030939Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030942Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030947Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030950Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030960Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030963Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030970Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030973Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030974Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030975Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030981Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030982Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030986Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030997Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031011Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031013Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 4A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031015Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031016Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031018Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031021Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031023Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031039Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031041Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031042Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031047Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031053Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031054Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031055Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031089Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031097Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031124Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031125Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031424Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031484Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031499Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031891Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031955Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031956Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032027Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032120Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ZODLETONE_000997102077657000Sulfur Spring Sediment And CrustLLSFPPATKGVWGMSWRQEAKKGVEDCDKPGGLVKRELIPGYPNDSGMNP
ZODLETONE_005568802077657000Sulfur Spring Sediment And CrustTTTPVSWHQEAMKGVEGCDKPGGAVKQALIPGFPN
ZODLETONE_000377402077657000Sulfur Spring Sediment And CrustWHQEAMKGVEVCEKLGGVDKQMMIPRFPNQHVLNP
ZODLETONE_004273302077657000Sulfur Spring Sediment And CrustHDDWGMSWRQKAKKGVEVCEKLGGVDKRAMIPRFPN
thermBogB3DRAFT_10126713300000336SoilPGTWGMSWRQEAMKGVEDCDKPGVAVKRAPIPGFPN*
Ga0068965_106034123300004471Peatlands SoilTKGMWGMSRRQEAMKGVENCEKPGGLVKRELIPGYPNNRALNP*
Ga0008092_1002641513300004629Tropical Rainforest SoilATKGVWGMSGRQEATKGVEDCDKPGGMVKRVLIPGCPNQPALNP*
Ga0066687_1054884523300005454SoilATKGVWGMPRRQKAMKGVEDCDKPGGLVKRELIPGSLNYPDVNP*
Ga0075024_10004878423300006047WatershedsVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGFLN*
Ga0075024_10084637313300006047WatershedsVWRISRCQEAMKGVEDCDKPGEAVKRALIPGFLNYCMLNS*
Ga0075028_10010389823300006050WatershedsVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGSLNEHPVNP*
Ga0007848_107460023300006111FreshwaterVWGMSWRQKAMKGVENCDKPWEAVKRALIQGFPNDRKLNP*
Ga0007855_113523623300006126FreshwaterVWGMSWRQKAMKGVENCVKPWEAVKRALIQGFPNDRKLNP*
Ga0075018_1011352723300006172WatershedsVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGYPN*
Ga0070712_10183634513300006175Corn, Switchgrass And Miscanthus RhizosphereMWGMSWRQKAMKGVEDCDKPGGTVKQVSSPGFPN*
Ga0075501_105913323300006355AqueousVWGMSWRQKAMKGVEGCEKPGGAVKRALILGSLNYCSLNT*
Ga0075501_107487523300006355AqueousVWGMSWHQKTKKGAENCDKPGGVVKQALIPGFLNKLTLNT*
Ga0075502_171891513300006357AqueousVWGMSWRQKAMKGVEGCEKPGEAVKRALIPGFPNYCTLNT*
Ga0075482_103266023300006364AqueousMSWHQKAKKGVEVCEKPGVVDKRTLIPGFPNQRALNS*
Ga0075483_102542723300006373AqueousMSWRQKAMKGVEGCDKLGGTVKQVLIPRYPNYCMMNP*
Ga0075483_105081723300006373AqueousVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNYCMLNT*
Ga0075483_107007723300006373AqueousVWRMSWRQVAMKGVEGCENLGGAVKRALIPRSLNYGILNS*
Ga0075498_111400423300006378AqueousMSWLQEALKGVEDCDKLGVFVKRKLIPRFPNRLAMNT*
Ga0075498_111990823300006378AqueousVWGMFWRQKAMKGVEGCDKPGEAVKRALIPGFPNYRILNT*
Ga0075492_100078423300006394AqueousVWGMSWRQKAMKGVEGCDKPGEAVKRALIPGYPNYRWLNT*
Ga0075500_12909223300006569AqueousVWRMSRRQEAMKGVEGCEKPGVAVKQAIIPGFPNYHVLNP*
Ga0075522_1035494023300006638Arctic Peat SoilVWGMSWRQKAKKGVENCEKSGGAVKRALIPESLNQPSLNA*
Ga0031679_100630123300006691Deep OceanVWGMSWCQEAMKGVEGCEKPGEAVKRALIPGSLNDRTLNT*
Ga0031693_100912023300006712Deep OceanMSWRQEAMKGVEGCDKPGEAVKRALIPGFPNYRMLNT*
Ga0066653_1043479613300006791SoilVWGMSWRQEAKKGVEDCDKPGGAVKRALRPGFPNGPTLNP*
Ga0066665_1071306923300006796SoilVWGMSWRQKAMKGVEDCEKPGVAVTRALIPGYPNDQELNP*
Ga0066660_1089773323300006800SoilMWGMSRRQQAMKGVEDCDKPGEAVKRALIPGCPNDRRLNP*
Ga0066660_1099765823300006800SoilVWGMPWHQEAMKGVEDCDKPGGSVKRELIPGSLNDPRVNP*
Ga0066660_1168463823300006800SoilMWGMSWRQEAMKGVEDCEKPGVAVNRALIPGYPNYRALNP*
Ga0075428_10029839423300006844Populus RhizosphereVWGMPWRQEAKKGVEDCDKPGGSVKRELIPGCPNQPVMNS*
Ga0063829_102922323300006860Peatlands SoilMWGMSRRQEAMKGVEDCDKPGGLVKRDLIPGYPNDRALNS*
Ga0063777_103334923300006861Peatlands SoilVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGCPNRRTVNP*
Ga0063777_103872923300006861Peatlands SoilVWGMSWRQEATKGAEDCDKSGGAVKRALIPEYPNYPTLNP*
Ga0073934_1042177013300006865Hot Spring SedimentMSWRQKAMKGVEGCDKPGGAVKQALIPGFPNDRTVNP*
Ga0073928_1108504713300006893Iron-Sulfur Acid SpringMWGMSWRQEAMKGVEDCEKPAGMVKRVLIPGYPN*
Ga0075424_10114001613300006904Populus RhizosphereMWGMSWRQEAMKGVEDCDKPGEMVKRVLIPGFPNWRVLNP*
Ga0080680_105266623300006934Tropical Rainforest SoilVWGMSGRQEAMKGVEDCDKPGGAVKQALSPGCPNHPVVNP*
Ga0080680_106868723300006934Tropical Rainforest SoilCGQATKGVWGMSWRQQAMKGVEDCDKPGGAVKRALSPGFLNERGLNP*
Ga0081246_105589023300006935Tropical Rainforest SoilVWGMSWRQEAMKGVEDCEKPGGAVKRALMPGFPNQHALNP*
Ga0081243_107819623300006937Tropical Rainforest SoilVWGMSWRQQAMKGVEDCDKPGGAVKQALSPGSPNHPA*
Ga0081243_109373423300006937Tropical Rainforest SoilVWGMSWRQEARKGVEDCEKPGGAVKRALIPGFPNYPRLNP*
Ga0081245_104037723300006938Tropical Rainforest SoilVWGMSRRREARKGVEDCDKPGGAVKRALRPGSPNHRPPNP*
Ga0081245_106883823300006938Tropical Rainforest SoilVWGMSRRQEAMKGVEDCDKPGGTVKRVLIPGFPN*
Ga0081244_103572823300006939Tropical Rainforest SoilVWGMSWRQEARKGVEDCDKPGGAVKRALRPGCPNQPALNP*
Ga0081244_107220913300006939Tropical Rainforest SoilVWGMSWRQKAMKGVEGCDKLGEAVKQALIPGSLNHHAPNP*
Ga0105055_1001127923300007519FreshwaterVWGMSWRQKAMKGVEGCDKPGGAVKRALIPGYPNYRRLNT*
Ga0105044_1070008723300007521FreshwaterVWGMSWHQKAMKGVEGCDKPGEAVKRALIPGFPNDRSLNT*
Ga0102861_116592323300007544EstuarineMWGMSWHQKTMKGAENCDNPGGAVKQALRPGYLNELTLNT*
Ga0105735_103873813300007860Estuary WaterVWGMSWRQKAMKGVEGCEKLGEAVKQALIPGYPNYRILNT*
Ga0103605_100497423300008559Hydrothermal VentsMSWRQEAVKGVEVCEKPGGVDKRTVIPGFLNWHVLNT*
Ga0103649_10023223300008578Host-AssociatedMWGMSRRQVAMKGVEGCDKPGGAVKRALIPGSLNYHGLNT*
Ga0103655_10021123300008584Host-AssociatedVWRMSRRQEAMKGVEGCEKPGVAVKQALIPGFPNYHVLNP*
Ga0103643_10099023300008590Host-AssociatedMSRRQQAKKGVKDCEKPGGVVNQALIPGYPNGRQLNP*
Ga0103654_10038923300008592Host-AssociatedMGGGQANKGVWRMSRRQEAMKGVEGCEKPGVAVKQALIPGFPNYHVLNP*
Ga0103645_10082323300008655Host-AssociatedMSRRQKAMKGVEGCDKLGEAVKQALIPRYPNHSMLNT*
Ga0103653_10066223300008661Host-AssociatedMSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT*
Ga0103653_10112523300008661Host-AssociatedTWGRQEAMKGVEDCDKPGGMVKRVLIPGFPNYLGVNP*
Ga0103638_100044423300008785Wetland SoilVWGMPWRQEAMKGVEDCDKLGGLVKRELIPRFPN*
Ga0105048_1003441463300009032FreshwaterVWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNDRTLNT*
Ga0105048_1013259223300009032FreshwaterMSWRQETKKGVEVCEKPGEADKQAMIPGSLNAVN*
Ga0099829_1046993223300009038Vadose Zone SoilMWGMSWRQEAMKGVAGCDKPGGVVKRALIPGFPNYRTLNP*
Ga0105090_1030185523300009075Freshwater SedimentVWGMSWRQKAMKGVEGCDKPGEVVKRALIPGSLNYRMLNT*
Ga0099830_1136284123300009088Vadose Zone SoilVWGMSWRQKAMKGVEGCDKLGEAVKQALIPGFPNDRAPNP*
Ga0099828_1121299223300009089Vadose Zone SoilMWGMSWRQEATKGVAGCDKPGGVVKRALIPGFPNYRTLNP*
Ga0079224_10142943823300009095Agricultural SoilMSWRQEAKKGVEVCEKPGEADKQAMIPGFLNTVD*
Ga0118728_104013823300009129MarineVIKSVWGMSRRQKAMKGVEGCEKPGGTVKRVLIPGFLNYCVLNP*
Ga0066709_10266478623300009137Grasslands SoilVWGMSRRQQAKKGVEDCDKPGGAVKRALIPGCPNDRALNP*
Ga0099792_1068762323300009143Vadose Zone SoilMWGMSRRQKAMKGVEDCDKPGGTVKRVLIPGFPNYPALNP*
Ga0103748_1001664223300009199Wastewater SludgeVWGMSWRQEAMKGAEGCEKPGGAVKRALRPGFPNWRGLNT*
Ga0103748_1004209923300009199Wastewater SludgeVWGMSWRQKAMKGVEGCEKPGEAVKRALIPGSLNYRSLNT*
Ga0103749_1002131723300009203Wastewater SludgeVWGMSRRQETMKGVEDCEKPGEAVKRALIPGCPNCRMLNP*
Ga0103749_1002520023300009203Wastewater SludgeVWGMPWRQEAMKGAEDCDKPGGLVKHELIPGFLNAVL*
Ga0103750_102227913300009206Wastewater SludgeMSWRQEAKKGVEDCDKLGGLVKRELIPRFPNRRGVNS*
Ga0103744_1018331423300009281Wastewater SludgeMWGMSWRQEAKKGVEDCEKPGGAVKRASIPGYPNERDLNP*
Ga0103747_1003026613300009295Wastewater SludgeATKGVWGMSWRQEAKKGVEDCDKPGGAVKRALRPGYPNRPSLNA*
Ga0103747_1010686423300009295Wastewater SludgeMWGMSWRQEAMKGVEDCEKLGLAVKRALNPRFPNDCALNP*
Ga0103786_100296423300009348Microbial MatsVWGMSRRQKAMKGVEDCDKPRGLVKRELIRGCLNDMH*
Ga0103786_100296523300009348Microbial MatsVWGMSRRQKAMKGVEDCDKPRGLVKRELIRGCLNDM*
Ga0103787_100740823300009349Microbial MatsVWGMSRRQKAMKGVEDCEKPRGLVKRELIRGSLNDVH*
Ga0116220_1009463323300009525Peatlands SoilMWGMSRRQEAMKGVENCEKPGGLVKRELIPGYPNNRALNP*
Ga0105238_1176987523300009551Corn RhizosphereVWRMSRRWKAMKGVEGCDKLGEAVKQALIPGFPNYHVPNP*
Ga0105249_1254197923300009553Switchgrass RhizosphereVWRMSWRQKAMKGVEGCDKLGEAVKQALIPRFPNYHAPNP*
Ga0105259_104405223300009597SoilVWGMSWRQEAMKGVEDCDKLGGLVKRELIPRFPN*
Ga0116125_112950023300009628PeatlandVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGFPNVVR*
Ga0116121_110643423300009644PeatlandMSWRQEALKGVEDCDKPGEVVKRTLIPGFPNWQALNP*
Ga0105857_128626023300009650Permafrost SoilMWGMSWRQKAKKGVEDCDKLGGLVKRELIPRSLNHLAVNP*
Ga0116215_103904823300009672Peatlands SoilVWGMSWRQEAMKGAEDCDKSGGAVKRALIPEFPNYHGLNP*
Ga0116224_1054347123300009683Peatlands SoilMWGMSWRQKARKGVEDSDKPGEAVKQALLPGFPNQPALNP*
Ga0114944_124430023300009691Thermal SpringsTKGVWGMSRRQKAMKGVEDCDKPGGVVKRALIPGCPNERALNP*
Ga0123377_101128513300009735MarineKGVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNYCMLNT*
Ga0131092_1023376723300009870Activated SludgeMWGMSWRQEAMKGVEDCEKLGVAVKRALNPRYPNDCALNP*
Ga0127462_16754913300010061Grasslands SoilANKGVWRMSRRQEAMKGVEGCEKPGVAVKQALIPGFPNYHVLNP*
Ga0127431_12339413300010063Grasslands SoilATKGVWGMSGRQEAMKGVEDCDKPGGTVKRVLIPGCPNQRMLNP*
Ga0127433_10355123300010064Grasslands SoilMSWRQKALKGVENCDKPGVIVKQVLIPGFPNWPASNP*
Ga0127435_15419123300010065Grasslands SoilMWGMSWRQEAIKGVEDCEKPGGAVKRVLIPGFPT*
Ga0127467_10562313300010069Grasslands SoilRQQAMKGVEDCDKPGGLVKRELIPGYPNERTLNP*
Ga0127467_12728223300010069Grasslands SoilWGMPWHQEAMKGVEDCDKPGGSVKRELIPGSLNDPAVNP*
Ga0127428_10425633300010072Grasslands SoilMSWRQKAMKGVANCDKLGGTVKRVLIPRYPNYPVLNP*
Ga0127428_10539213300010072Grasslands SoilWGMSWRQEATKGVENCDKPGEVVKRALIPGSPNQPALNP*
Ga0127439_13159423300010074Grasslands SoilTKGVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGCPNYRVLNS*
Ga0127439_13778523300010074Grasslands SoilVWGMSRRQEARKGVEDCEKPGGAVKRALRPGCPNHPTLNP*
Ga0127434_10716523300010075Grasslands SoilVWGMSWRQKAMKGVEGCEKPGEAVKRALIPGYPNDRTLNP*
Ga0127434_12724613300010075Grasslands SoilMSWRQEAMKGVANCDKLGEVVKRTLIPRFPNHRTLNP*
Ga0127434_14298723300010075Grasslands SoilMVMGIVAAWRQEAMKGVEDCEKPGGAVKRALRPGFPNRRVLNP*
Ga0127487_13836423300010078Grasslands SoilGMWGMSWRQKAMKGVEDCDKLGVAVKQALIPRFPNYRALNP*
Ga0127469_13964123300010082Grasslands SoilMWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGFPNEPPLNP*
Ga0127469_15605813300010082Grasslands SoilWGMSRRQEAMKGVEDCDKPGEAVKRALIPGSLNQRMLNP*
Ga0127478_109697023300010083Grasslands SoilMWGMSWRQEAMKGVEDCDKPGGVVKQALIPGYPN*
Ga0127496_103597813300010086Grasslands SoilATKGVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGYPNYPRLNP*
Ga0127496_108822433300010086Grasslands SoilKGVWGMSWRQEAMKGVEDCDKPGGVVKRAMIPGCPNGVR*
Ga0127476_102436623300010088Grasslands SoilVWGMSGRQKAMKGVEDCDKPGGMVKRVLIPGCPNNHVLNS*
Ga0127485_108235623300010091Grasslands SoilMWGMSWRQEAMKGVEDCEKPGVAVNRALIPGFPNYRALNP*
Ga0127468_103401423300010092Grasslands SoilKGVWGMPRRQKAMKGVEDCDKPGGLVKRELIPGSLNYLTVNP*
Ga0127468_109284723300010092Grasslands SoilMWGMSWRQEATKGVENCDKPGEVVKRALIPGFPNQAMLNP*
Ga0127490_101165723300010093Grasslands SoilVWGMSWRQEARKGVEDCDKPGGAVKRALRPGYPNDRALNP*
Ga0127480_104529513300010094Grasslands SoilATKGVWGMPGRQAAKKGVENCDKLGGAVKRALIPRCPNRPALNK*
Ga0127473_101831023300010096Grasslands SoilVWGMSRRQKAMKGVEDCDKPGGAVKRALRPGYPNDQALNP*
Ga0127473_105639123300010096Grasslands SoilVWGMSGRQKAMKGVEDCDKPGGTVKRVLIPGCPNHHALNP*
Ga0127473_109677323300010096Grasslands SoilWGMSWRQKAMKGVEDCDKLGVAVIRALIPRSLNHRELNP*
Ga0127463_109618523300010098Grasslands SoilVWGMSWRQEATKGVEDCEKPGGAVKRALIPGCPNHPRVNP*
Ga0127450_104767823300010099Grasslands SoilVWGMSRRQEAMKGAAGCDKPGGAVNEALRPGFPNYRVLNP*
Ga0127440_109015913300010100Grasslands SoilGVWGMSRRQEATKGVEDCDKPGEAVKRALIPGFPNQRTLNP*
Ga0127453_106313223300010102Grasslands SoilMRGMSRRQEAKKGVEDCEKLGGVVKRTMIPRFPNRRALNP*
Ga0127453_106740023300010102Grasslands SoilMPWRQEAMKGVSDCDKPGRAVNEALNPGSPNQRRVNP*
Ga0127446_102340123300010104Grasslands SoilVWGMSWRQEATKGVEDCDKPGGAVKRALIPGCPNHPAVNP*
Ga0127470_105272313300010105Grasslands SoilRQQAMKGVEDCDKLGGLVKRELIPRSLNYPCVNP*
Ga0127494_102504923300010107Grasslands SoilVWGMPRRQQAKKGVEDCDKPGGLVKHELIPGSLNYPGVNP*
Ga0127460_107153423300010114Grasslands SoilMWGMSWRQEAMKGVEDCDKPGGAVKRALRPGFPNDHALNP*
Ga0127466_111736833300010116Grasslands SoilVWGMSRRQEATKGVEDCEKPGGAVKRAMMPGYPNGQQLNP*
Ga0127465_109433213300010118Grasslands SoilKGAWGMSWRQKALKDVEDCDMLGGAVKKVLIPRSPMNLH*
Ga0127451_107569513300010120Grasslands SoilGVWGMSGRREAMKGAEGCDKPRGAVKQALIRGYPNDRRLNP*
Ga0127438_116783223300010121Grasslands SoilMRGMSRRQEAKKGVEDCEKLGGVVKRTMIPRFPNRRELNP*
Ga0127479_104484613300010123Grasslands SoilTKGMWGMSWRQEAMKGVEDCDKPGETVKRVLIPGFPN*
Ga0127479_117037223300010123Grasslands SoilGMSWRQEAMKGVEDCDKLGGAAKRALIPRFPNDVR*
Ga0127486_116960123300010128Grasslands SoilMWGMSRRQEATKGVEDCDKPGEAVKRALIPGFPNQRTLNP*
Ga0127459_104358013300010133Grasslands SoilGMSRRQEAMKGVEDCEKPGGAVKRALRPGSLNYHALNP*
Ga0115595_106638723300010138WetlandVWGMSWRQKAMKGVEGCDKPGEVVKRALIPGSLNDRMLNT*
Ga0127464_119914023300010139Grasslands SoilMSWRQEAKKGVENCDKPGGAVKRALIPGSLNYRSVNP*
Ga0127499_110927323300010141Grasslands SoilRQEAMKGVEDCDKPGGLVKRELIPGSLNYSGVNP*
Ga0126322_104853923300010143SoilVWGMSWRQEAMKGVEDCDKPGEAVKRALIPGCPNYRALNP*
Ga0126321_130469013300010145SoilTKGVWGMSWRQEAKKGVEDCDNPGGAVKRALRPGCPN*
Ga0074044_1065437623300010343Bog Forest SoilVWGMSWRQEAMKGVEDCDKLGGLVKRELIPRSLN*
Ga0116240_1062565323300010349Anaerobic Digestor SludgeVWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNDRILNT*
Ga0126370_1192515323300010358Tropical Forest SoilMWGMSGRQKAMKGAEDCDKPGEAVKRALRPGFPNDRTLNP*
Ga0126376_1215876623300010359Tropical Forest SoilVWGMPWRQEAMKGVEDCDKLGELVKRELIPRFPNQLRVNP*
Ga0105239_1096685223300010375Corn RhizosphereVWGMPWRQKAMKGVEDCDKLGGLVKRELIPRSLNQLHVNP*
Ga0136449_10411364423300010379Peatlands SoilMWGMSWRQEARKGVEDCDKPGGAVKQALSPGFPNDRSVNP*
Ga0136847_1063859323300010391Freshwater SedimentVWGMSWRQKAMKSVEDCDKPGEAVKRALIPGSSNQRTLNP*
Ga0126383_1125763623300010398Tropical Forest SoilVWGMSWRQEAMKGVENCDKPGGLVKRELIPGSLNNHVLNP*
Ga0134121_1008539823300010401Terrestrial SoilVWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGSLN*
Ga0126354_107389723300010857Boreal Forest SoilVWGMSWRQEAMKGVEDCDKPGEAVKRALIPGFPN*
Ga0126354_115411813300010857Boreal Forest SoilVWGMSWRQKAMKGVEGCEKLGEAVKQALIPRSLNYRAPNP*
Ga0126352_106417523300010859Boreal Forest SoilVWGMSGRQKAMKGVEDCDKPGGAVNRALIPGSLN*
Ga0126351_105863523300010860Boreal Forest SoilVWGMSGRREAMKGVEGCDKPRGAVKRALIRGYPNDPAPNP*
Ga0126349_126910323300010861Boreal Forest SoilMWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRSLNEPSLNP*
Ga0126349_130652323300010861Boreal Forest SoilVWGMSWRQEAMKGVEDCDKPGGVVKRALIPGSLNVRELNP*
Ga0126359_112221123300010869Boreal Forest SoilVWGMSWRQEAMKGVEGCEKPGEAVKQALIPGFPNVVR*
Ga0136897_1083678323300010872SoilMWGMSWRQKAMKGVEDCEKPGGMVKRVLIPGSLNERGVNT*
Ga0138111_109745513300010896Grasslands SoilGMSRRQEAMKGVEDCEKLGGVVKRTLIPRFPNRPALNP*
Ga0138543_13207823300011031Peatlands SoilVWGMSRRQKAMKSVEDCDKPGGAVNRALIPGCPNDRVLNP*
Ga0138542_14086023300011035Peatlands SoilMWGMSWRQKAKKGVEDCEKPGEAVKRALIPGYPNQHRLNP*
Ga0138591_10231813300011041Peatlands SoilTKGVWGMSWRQEAMKGAEDCDKSGGAVKRALIPEFPNYHGRSQG*
Ga0138554_17560323300011049Peatlands SoilMWRMSWRQKAKKGVEDCDKPGGTVKRVLIPGSLN*
Ga0138540_11361923300011051Peatlands SoilMWGMSRRQEAKKGVEDCDKPGGAVKQALMPGCPNWSALNP*
Ga0138544_109344123300011057Peatlands SoilMWGMSRRQEAKKGVEDCDKPGGAVKQALMPGYPNWSALNP*
Ga0138597_103558923300011059Peatlands SoilVWGMSRRQKAMKGVEDCDKPGGPVNRALIPGCPNDRVLNP*
Ga0138594_100513323300011067Peatlands SoilVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGFPN*
Ga0138595_101652933300011071Peatlands SoilMWGMSWRQKARKGVEDCDKPGEAVKQALLPGFPNQPALNP*
Ga0138584_104128423300011073Peatlands SoilVWGMSRRQKAMKGVEDCDKPGGAVNRAFIPGCPNDRVLNP*
Ga0138555_108554923300011075Peatlands SoilVWGMSWRQEAMKGAEDCDKSGEAVKRALIPEFPNYHALNP*
Ga0138565_112441223300011078Peatlands SoilMSWRQEALKGVEDCDKPGVVVKRTLIPGYPNWHTLNP*
Ga0138568_102533823300011080Peatlands SoilVWGMSCRQEAMKGAEDCDKSGGAVKRALIPEFPNYHGLNP*
Ga0138568_120285323300011080Peatlands SoilMWGMSWRQEAMKGVEDCDKPGEAVKRALSPGYPNERVLNP*
Ga0138575_103890623300011081Peatlands SoilVWGMSWRQEAMKGVEDCDKPGEAVKRALSPGFPN*
Ga0138562_120865623300011084Peatlands SoilVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGSLNVIR*
Ga0138579_111791323300011090Peatlands SoilMWGMSWRQKAMKGVENCDKPGGAVKRASIPGFPNRRTLNP*
Ga0150983_1209099723300011120Forest SoilVWGMSWRQEATKGAEDCDKSGGAVKRALIPEFPNYHRLNP*
Ga0150983_1634129023300011120Forest SoilMWGMSWRQEAMKGVEDCDKLGGLVKRELIPRFPN*
Ga0137393_1028587723300011271Vadose Zone SoilVWGMSWRQKAMKGVEGCEKLGEAVKQALIPGFPNDRAPNP*
Ga0138364_111521623300011300MarineMSWRQVAMKGVEGCEKPGGAVKRALIPGSLNYRTLNL*
Ga0138399_102263523300011316MarineVWGMSWCQEAMKGVEGCEKPGEAVKRALIPGSLNYRTLNT*
Ga0138398_112829723300011327MarineMWRMSWRQEAMKGVEGCDKPGEAVKRALIPGFPNYRMLNT*
Ga0151652_1275734513300011340WetlandKGMWGMSWRQEAMKGVANCDKLGEVVKRTLIPRFPNYRTLNP*
Ga0153951_104317023300011404Attine Ant Fungus GardensVWGMSRRQEAMKGVEDCDKPGELVKRELIPGFPNDLRLNS*
Ga0153943_106907623300012177Attine Ant Fungus GardensVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNHPALNP*
Ga0153974_110291423300012180Attine Ant Fungus GardensVWGMSWRQEATKGVEDCDNPGGAVKRALRPGCPNYRTLNP*
Ga0153922_111103223300012181Attine Ant Fungus GardensVWGMSRRQEAMKGVEDCDKPGGLVKRELIPGFPNGRALNP*
Ga0137362_1086193523300012205Vadose Zone SoilVWGMSWRQEAMKGVAGCDKPGGVVKRALIPGFPNDRTLNP*
Ga0137377_1070635723300012211Vadose Zone SoilMWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGYPN*
Ga0150985_10083232023300012212Avena Fatua RhizosphereVWGMSRRQNAMKGVEDCDKLGGMVNRVLIPRFPNYLRVNT*
Ga0150985_10144913723300012212Avena Fatua RhizosphereVWGMSWRQEATKGVEDCDKPGGAVNRALIPGCPNGRTLNP*
Ga0150985_10592548423300012212Avena Fatua RhizosphereVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGCPNDPALNP*
Ga0150985_11049220813300012212Avena Fatua RhizosphereSATKGVWGMSWRQQARKGVEDCDKPGEAVKRALIPGYPNQSDLNP*
Ga0150985_11116491323300012212Avena Fatua RhizosphereMWGMSRRQQAMKGVEDCDKPGETVKQVLRPGFPN*
Ga0134028_124610923300012224Grasslands SoilVRIAVNEAQGVWGMSGRREATKGVEGCDKPRGAVKRALIRGFPNDPVPNP*
Ga0137369_1037707623300012355Vadose Zone SoilMSWRQQATKGVEDCDKPGGSVKRELIPGYPNQPALNP*
Ga0137360_1133551723300012361Vadose Zone SoilVWGMPRRQQAKKGVEDCDKLGGLVKRELIPRSLNHLRVNP*
Ga0137390_1112589423300012363Vadose Zone SoilMWGMSWRQEAMKGVAGCDKPGGVVKRALIPGFPNDRTLNP*
Ga0134027_107095223300012364Grasslands SoilMPRRQQAMKDVEGCEKPGRAAKQALKPGSPNDRVLNP*
Ga0134032_108283213300012376Grasslands SoilATKGVCGMSWRRQAMKGVEDCDKPGEAVKRALQPGSLNQPTLNP*
Ga0134023_124993523300012385Grasslands SoilVWGMSWRQEATKGVEDCDKPGGAVKRALRPGYPNRPALNP*
Ga0134046_105546023300012386Grasslands SoilMWGVSGRQEAMKGVEDCDKPGGMVKRVLIPGSLNQPALNP*
Ga0134040_120206013300012389Grasslands SoilATKGMWGMSRRQEAMKGVEDCDKPGGSVKRELIPGSLNDPSVNT*
Ga0134054_127884313300012390Grasslands SoilATKGVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNYPALNP*
Ga0134024_137333313300012404Grasslands SoilATKGVWGMSGRREARKGAADCDKPGGADNRALIPGCPNHRTLNP*
Ga0134041_124109323300012405Grasslands SoilVWGMSWRQEAMKGVEDCDKPGEAVKRALIPGFPNYPVLNP*
Ga0134050_129625523300012407Grasslands SoilMWGMSWRQEAMKGVEDCDKPGGTVKRVSSPGFPNQRTLNP*
Ga0150984_10520617123300012469Avena Fatua RhizosphereMWGMSWHQKAKKGVEDCDKLGGMVKRVLIPRFPNDPKLNP*
Ga0150984_10521373923300012469Avena Fatua RhizosphereVWGMSRRQKAMKGVEDCDKLGGMVNRVLIPRFPNYLRVNT*
Ga0150984_10626970023300012469Avena Fatua RhizosphereMWGMSRRQQAMKGVEDCDKPGGAVKRALRPGFPNQRTLNP*
Ga0150984_10910708323300012469Avena Fatua RhizosphereMSWRREAKKGVEDCEKLGGAVKRALIPRSLNQHALNP*
Ga0150984_12009344023300012469Avena Fatua RhizosphereMWGMSRRQEAMKGVEDCDNPGGAVKRALRPGYPNDHTLNP*
Ga0150984_12029392623300012469Avena Fatua RhizosphereVWGMSWRQEAMKGVEDCEKPSRAVKRVLTLGFPN*
Ga0137398_1108314623300012683Vadose Zone SoilMWGMSRRQEAMKGVEDCDKPGEAVKRALIPGSLNQQPLNP*
Ga0157573_104294823300012693FreshwaterVWRISRCQEAMKGVEDCDKPGEAVKQALIPGFLNDCMLNS*
Ga0157525_11855723300012737FreshwaterVWGMSWRQKAMKGVEGCDKPGEAVKQALIPGFPNDRALNP*
Ga0138276_100184413300012768Freshwater LakeANKGVWRMSRRQEAMKGVEGCEKPGVAVKQAIIPGFPNYHVLNP*
Ga0138291_104450923300012770Freshwater LakeVWGMSWRQKAMKGVEGCDKPGEVVKRALIPGSLNDRMLNK*
Ga0138280_121501323300012775Freshwater LakeVWGMSWRQEAMKGVEDCDKPGELVKRELIPGFPNNHALNP*
Ga0138275_105693423300012776Freshwater LakeVWGMSWRQKAKKGVEGCDKPGEAVKRALIPGFPNYRTLNT*
Ga0157283_1014505823300012907SoilVWGMPWRQEAMKGVEDCDKLGGLVKRELIPRSLN*
Ga0134110_1052744123300012975Grasslands SoilMWGMSRRQEATKGVEDCDKPGGAVKRALIPGSLN*
(restricted) Ga0172365_1016738423300013127SedimentMSRRQEALKGVEDCEKSGGVVKQALIPEYPNRRTLNP*
Ga0170791_1237439023300013295FreshwaterVWRMSRCQEAMKGVEDCEKPGEAVKQALIPGFLNYCMLNS*
Ga0120181_115016723300013766PermafrostVWGMSGRQEAMKGVEDCDNLGGAVNRALRPRSLN*
Ga0134078_1050802023300014157Grasslands SoilVWGMSWRQEARKGVEDCDKPGGTVKRVLIPGFPN*
Ga0181532_1014212423300014164BogVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNVVR*
Ga0181523_1005514323300014165BogMSWRQEALKGVEDCDKPGEVVKRTLIPGYPNWHALNP*
Ga0181537_1017069023300014201BogVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNVIR*
Ga0075341_110613123300014298Natural And Restored WetlandsVWGMPWRQKAMKGVEDCDKLGGLVKRELIPRSLN*
Ga0181516_1057779823300014655BogVWGMSWRQEAMKGVEDCDKPGGAVNRALRPGSLNWRVLNP*
Ga0182030_1038599423300014838BogMSWRQEALKGVEDCDKPGEVVKRTLIPGYPNWHALNS*
Ga0180062_109827713300014879SoilCGQATKGVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGYPNQRTVNP*
Ga0173478_1044410623300015201SoilVWRMSRRQEAMKGVEGCDMPGVAVKQAMIPGFPNYHALNP*
Ga0137409_1054471923300015245Vadose Zone SoilMWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGSLNERRVNP*
Ga0163144_1059556923300015360Freshwater Microbial MatMSWRQKAMKGVEGCDKSGEAVKRALIPESLNYRLLNT*
Ga0132256_10300280923300015372Arabidopsis RhizosphereMWGMSWRQKAMKGVEDCEKPGEAVKQALIPGSLNHRTLNP*
Ga0182035_1071843523300016341SoilVWGMSGRQEAMKGVEGCDKPGEAVKRALIPGSPNHRTLNP
Ga0180042_15471223300016683FreshwaterVWGMSWRQKAMKGVEGCDKPGEVVKRALIPGSLNDRMLNK
Ga0181513_118172723300016700PeatlandVWGMPWRQEARKGVEDCDKPGEAVKRALIPGFPNERVLNP
Ga0181507_103614913300016705PeatlandWGMSWRQEALKGVEDCDKLGGAVKRALIPGYPNWHALNS
Ga0181505_1027060823300016750PeatlandVWGMSWRQKAMKGVEDCEKPGVAVKRALMPGYPNERALNP
Ga0181505_1035771213300016750PeatlandATKGMWGMSWRQQAMKGVEDCEKPGEAVKRALSPGFPNYSRMNP
Ga0181505_1066732313300016750PeatlandWGMSWRQQAMKGVEDCEKPGVAVTRALSPGSLNDRQLNP
Ga0181505_1090216013300016750PeatlandMPRRQEAMKGVEDCDKPGGLVKRDLIPGSLNYPGVNP
Ga0187785_1061046123300017947Tropical PeatlandMWGMSWRQKAMKGVEDCDKLGVAVKQALIPRFPNYRAMNP
Ga0187782_1039652623300017975Tropical PeatlandVWGMSRRQKAMKGVEDCDKPGGLVKRELIPGCPNDRVLNS
Ga0187822_1032331723300017994Freshwater SedimentVWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGFPNQRTLNP
Ga0187788_1036942923300018032Tropical PeatlandVWGMSRRQEAMKGVEDCDKPGGLVKRELIPGSPNYHVLNP
Ga0187887_1004418423300018043PeatlandVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNDVR
Ga0187766_1090676023300018058Tropical PeatlandVWGMSRRQEAMKGVEDCDKPGGLVKRELIPGSLNHLHVNP
Ga0187765_1049933123300018060Tropical PeatlandVWGMSWRQKAMKGVEGCDKPGEAVKQALIPGSPIVVR
Ga0187765_1118202523300018060Tropical PeatlandVWGMSWRQEATKGAEDCDKSGGAVKRALIPEFPNHHGPNP
Ga0187770_1038756823300018090Tropical PeatlandVWGMSWRQEAMKGVEDCDKPGEAVKRALIPGFPNGQVLNP
Ga0180034_108589123300019207EstuarineVWGMSWRQKAMKGVEGCDKPGEAVKRALIPGSLNYRMLNT
Ga0180110_114876523300019208Groundwater SedimentMSRRQKAMKGVEGCDKLGEAVKQALIPGFPNDRAPNP
Ga0180119_123993723300019228Groundwater SedimentVWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNDRILNT
Ga0180112_135794813300019238Groundwater SedimentATKGVWGMSWRQKAMKGVEDCDKPGGAVKRALIPGSPNQPAPNP
Ga0181510_133434123300019240PeatlandMWGMSWRQKAKKGVEDCDKPGEAVKRALIPGYPNQRRLNP
Ga0181508_108286123300019256PeatlandVWGMPRRQEAMKGVEDCDKPGGLVKRDLIPGSLNYPGVNP
Ga0181504_111121713300019258PeatlandTKGVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGSLNDTH
Ga0181504_143954623300019258PeatlandKGVWGMSRRQEAMKGVEDCEKPGGLVKRELIPGYPNNRALNP
Ga0184646_125789723300019259Groundwater SedimentVWGMSRRQQAMKGVEDCDKPGGAVKRALMPGFPNYRILNP
Ga0184647_139790223300019263Groundwater SedimentMWGMSWRWKAMKGVEDCEKLGEAVKQALIPRSLNAAY
Ga0187796_138511423300019264PeatlandMSWRQEAMKGVEDCDKPGGMVKRVLIPGSLNERVVNP
Ga0187792_170342323300019265PeatlandVWGMSWRQEAMKGVEDCDKPGVAVKRALIPGYPNERVLNP
Ga0181514_102135913300019268PeatlandATKGMWGMSGRQKAMKGVEDCDKPGGAVKRALRPGCPN
Ga0187794_106374213300019273PeatlandWGMSWRQEATKGVEDCDKPGGAVKRALIPGSLNQPALNP
Ga0180118_128920323300020063Groundwater SedimentVWGMSWRQEAMKGVEDCDKLGGMVKRVLIPRSLNHRGVNP
Ga0184649_113558013300020068Groundwater SedimentKGVWGMPRRQQAMKGVEDCDKPGGLVKRELIPGSLN
Ga0206355_143039223300020076Corn, Switchgrass And Miscanthus RhizosphereVPVLVAKGVWGMSWRQEAMKGVEDCDKRGGAVNRALIPRSLNYLALNP
Ga0206350_1078104413300020080Corn, Switchgrass And Miscanthus RhizosphereQATKGVWGMSWRQEARKGVEDCDNPGGAVKRALRPGSPNHHPLNP
Ga0206353_1197045313300020082Corn, Switchgrass And Miscanthus RhizosphereATKGVWGMPWHQEAMKGAEDCDKRGGAVKRALIPRSLNDPAVNP
Ga0194049_100762023300020157Anoxic Zone FreshwaterMWGMSWHQKTMKGAENCDNPGGAVKQALRPGYLNELTLNT
Ga0163147_1003574143300020192Freshwater Microbial MatVWGMSWRQKAMKGVEGCDKSGEAVKRALIPESLNYRLLNT
Ga0163150_1037642723300020195Freshwater Microbial MatMSWRQKALKGVEDCEKLGGIVKRVMIPRFPNKHVLNS
Ga0194121_1002312733300020200Freshwater LakeMPRRQQAKKGVEDCDKPGGLVKRELIPGSLNHLHVNP
Ga0179584_108965023300021151Vadose Zone SoilMWGMSWRQEARKGVEDCDKPGETVKQVLIPGYPNDRVVNP
Ga0210400_1115819423300021170SoilMWGMSRRQEAMKGVENCEKPGGLVKRELIPGFPNDRALNP
Ga0210345_14537923300021258EstuarineMWGMSRRQEAMKGVEDCDKPGELVKRELIPGYPNDRRLNP
Ga0210348_11412023300021266EstuarineVWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNYRILNT
Ga0210348_12373423300021266EstuarineTKGVWGMSWRQEAMKGVEDCDKPGGLVKRELSPGFPNYRTLNP
Ga0210356_14382323300021269EstuarineMSWCQEAIKGVEGCDKLGVAVKQALIPRFPNCRTVNQ
Ga0210352_13189223300021277EstuarineVWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNYRTLNT
Ga0210302_111600723300021299EstuarineVWGMSWRQKAMKGVEGCDKPGEVVKRALIPGSLNDRMLNT
Ga0210331_105069823300021304EstuarineVWGMSWRQKAMKGVEGCDKPGEAVKRALIPGSLNHRMMNT
Ga0210333_134287823300021313EstuarineVWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNDRTLNT
Ga0210370_117140423300021314EstuarineMWGMPWRQEAKKGVEDCEKPGGLVKRELIPGYPNERDVNT
Ga0213882_1009023323300021362Exposed RockVWGMSRRQEATKGVEDCDKPGEAVKRALIPGSLNQPALNP
Ga0213875_1028598923300021388Plant RootsVWGMSGRQEAMKGVEDCDNPGGAVNRALRPGCPNQRVLNP
Ga0210386_1009917323300021406SoilVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNVIR
Ga0126371_1156162623300021560Tropical Forest SoilVWGMSWRQEARKGVEDCDKPGGAVKRALRPGFPNQRTLNP
Ga0210361_14168423300021844EstuarineMSWRQKAMKGVEGCDKLGGTVKQVLIPRYPNYRTMNP
Ga0210361_17053023300021844EstuarineVWGMSWRQKAMKGVEGCEKPGVAVKRALIPGFPNYRALNP
Ga0210317_113809323300021852EstuarineVDQATKGTWGMSWRRKAMKGVEDCEKPGGVVKRALIPGYLN
Ga0213851_125272223300021860WatershedsVWGMPRRQKAKKGVEDCDKLGGLVKRELIPRSLNHLAVNP
Ga0213851_137839323300021860WatershedsVWGMSWRQEAMKGAEDCDKPGEAVKRALMPGFPNERRLNP
Ga0213856_126332923300021947WatershedsMWGMSRRQVAMKGVEGCDKPGGAVKRALIPGSLNYHGLNT
Ga0213856_128840523300021947WatershedsVWGMSWRQEELKDVDDCDKPGGLVKRELIPGYPNDHVLNP
Ga0213932_106381913300022166FreshwaterATKGVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNYHGVNP
Ga0242644_100712123300022498SoilMWGMSRRQEAKKGVEDCDKPGGAVKQALMPGCPNWSALNP
Ga0242644_101245123300022498SoilVGVLLVRWGMSWRQEAMKGVEDCEKPGEAVKRALIPGYPNRPRLNP
Ga0242644_101256613300022498SoilATKGMWGMSGRQKAMKGVEDCDKPGQAVKRALTPGFPNYPTLNP
Ga0242644_103756513300022498SoilVWGMSWRQEATKGAEGCDKLGGAVKRALIPRYPNHHALNP
Ga0242641_101072023300022499SoilMSRRQKAKKGVEDCEKPGGAVKRALMPGYPNRHALNP
Ga0242641_101084113300022499SoilQATKGMWGMSWRQEAMKGVEDCDKPGEMVKRVMIPGYPNERVLNP
Ga0242641_101280123300022499SoilMSGRQKAMKGAEDCDKSGEAVKRALIPEYPNRHALNP
Ga0242641_103050523300022499SoilWGMSWRQEAMKGVEDCDKPGGTVKQVSSPGFPNQRTLNP
Ga0242641_104665123300022499SoilWGMSWRQEAKKGVEDCEKPGGAVKRALIPGYPNERVLNP
Ga0242643_10143523300022500SoilMWGMSWRQEAKTGVEGCEKPGEAVKRALIPGFPNYLALNQ
Ga0242643_10557533300022500SoilGMSRRQEAMKGVEDCDKPGELVKRELIPGYPNYHVLNS
Ga0242643_11362023300022500SoilMWGMSRRQQAMKGVEDCDKPGETVKQVLIPGFPNGYPLNP
Ga0242645_100623323300022501SoilVWGMPWHQEAMKGVEDCDKPGGSVKRELIPGYLNDSGMNP
Ga0242645_102324413300022501SoilMSWRQEATKGAEDCDKPGGAVKQALRPGFPNQRMLNP
Ga0242645_103064423300022501SoilMWGMSWRQKAKKGVEDCEKPGEAVKRALIPGYPNRLRLNP
Ga0242646_102954913300022502SoilTKGMWGMSWRQEATKGVEDCDKLGGVVKRTLIPRYPN
Ga0242650_100735323300022503SoilMWGMSRRQEAMKGVENCEKPGGLVKRELIPGFPNNRALNP
Ga0242650_101470513300022503SoilVTKGMWGMSRRQEAMKGVEDCDKPGGLVKRELIPGYPNDPALNP
Ga0242642_100150033300022504SoilKGMWGMSRRQEAMKGVENCEKPGGLVKRELIPGYPNNRALNP
Ga0242642_100355413300022504SoilIKGVWRMSRRQEAMKGVEDCDKPGEAVKRALIPGFLNYCMLNS
Ga0242642_100840323300022504SoilVWGMSGRQEAMKGVEDCDKPGGAVKQALSPGCPNYRVLNP
Ga0242642_100937533300022504SoilATKGVWGMSWRQEATKGAEDCDKSGGAVKRALIPEFPNYHMLNPIGV
Ga0242642_101048023300022504SoilVWGMSWRQEAMKGVEDCDKLGGVVKRALIPRSLNQHRLNP
Ga0242642_101049723300022504SoilATKGVWGMSWRRQAMKGVEDCDKPGGVVKRALIPGSLNYPGLNP
Ga0242642_101922413300022504SoilKGMWGMSWRQEAMKGVADCDKPGGVVKRTLIPGCPNQHVLNP
Ga0242642_102798723300022504SoilMWGMSWRQEAMKGVEDCDKPGGVVKRALIPGFPNYRVLNP
Ga0242642_104176623300022504SoilGMSWRQEAMKGVEDCDKPGEAVNRALIPGFPNYRQLNP
Ga0242642_105382523300022504SoilMWGMSRRQEAMKGVEDCEKPGELVKRELIPGFPNNRALNP
Ga0242642_105717033300022504SoilTKGVWGMSRRQKAMKGVEDCDKPGEAVKRALIPGCPNYRVLNP
Ga0242642_107625213300022504SoilKGVWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRSLNQPWLNP
Ga0242642_108027923300022504SoilMWGMSGRQQAMKGVEDCDKPGEVVKRALIPGFPNYRALNP
Ga0242642_109979823300022504SoilVWGMSWRQEATKGVEDCDKPGGLVKRELIPGFPNYQALNP
Ga0242642_110303913300022504SoilATKGVWGMSWRRQAMKGVEDCDKPGEAVKRALRPGFPNDPALNP
Ga0242647_100155923300022505SoilWHQEAMKGVEDCDKPGGSVKRELIPGYLNDSGMNP
Ga0242647_100878623300022505SoilGMWGMSWRQEAMKGVEDCDNPGGAVNRALRPGSLN
Ga0242647_102203423300022505SoilVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGYPNERVLNP
Ga0242648_100776213300022506SoilTKGVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGSLN
Ga0242648_103711013300022506SoilKGVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNQF
Ga0242648_104537623300022506SoilGMSGRQEATKGVEDCDKPGGAVKRALRPGYPNQRVLNP
Ga0222729_100164513300022507SoilASKGVWGMSWRQEAMKGVEDCEKPGGAVKRALILGSLNQRMLNP
Ga0222729_100570613300022507SoilATKGMWGMSWRQKAMKGVEDCDKLGEAVKRALIPRGNHV
Ga0222729_100719213300022507SoilKGRWGMSWRQEATTGVEDCDKPGEAVKRALIPGSLNQRALNS
Ga0222729_103688623300022507SoilVWGMPRRQKAMKGVEDCEKPGEAVKRALIPGYPNWPMLNP
Ga0222729_105389823300022507SoilVTKGVWGMSRRQEARKGVEDCDKPGGLVKRELIPANTEDPEF
Ga0222729_105580213300022507SoilATKGVWGMSWRQEAMKGVEDCDKPGEAVKRALIPGSLN
Ga0222728_102780623300022508SoilATKGMWGMSWRQEAMKGVEDCDKPGGVVKRTLIPGSLN
Ga0222728_103169813300022508SoilGMSWRQEAMKGVEDCDKPGEAVKRALIPGCPNYRTLNP
Ga0222728_104627923300022508SoilVWGMSWRQETMKGVEDCEKPGGAVKQALMPGCPNWSALNP
Ga0222728_105745013300022508SoilGMWGMSRRQEATKGVEDCDKPGGAVKRALIPGCPNQRVLNP
Ga0222728_108495113300022508SoilMSWRQEAMKGVEDCDKPGETVKRVLIPAYFARVFGR
Ga0242649_100657423300022509SoilWGMSWRQEAMKGVEDCDKPGGAVKRALRPGSLNYPTLNP
Ga0242649_100686923300022509SoilVWGMPWRQEATKGVEDCDKPGEAVKRALIPGSLNWRTLNP
Ga0242649_101099213300022509SoilWGMSWRQQAMKGVEDCDKPGGAVKRALSPGYPNYRGPNP
Ga0242649_102794513300022509SoilGMWGMSRRQQAMKGVEDCDKPGGAVTRALRPGFPN
Ga0242649_103304513300022509SoilGVWGMSWRQEAMKGVEDCDKPGGAVNRALRPGSLN
Ga0242649_105453423300022509SoilVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNQRSVNP
Ga0242649_105618123300022509SoilSWRQKAMKGVEDCDKPGGMVKRVLIPGSLNYRALNP
Ga0242649_107241023300022509SoilVWGMPWRQEAMKGVEDCDKPGELVKRELIPGFPNYLGVNP
Ga0242649_107295313300022509SoilTKGMWGMSWRQKAMKGVEDCDNPGGVVKRALIPGYPH
Ga0242652_103306613300022510SoilWGMSWRQEAMKGVEDCDKPGEVVKRTLIPGFPNWRTLNP
Ga0242651_102012023300022511SoilKGVWGMSRRQKAMKGVEDCDKPGGAVNRALSPGCPNHRVLNP
Ga0242651_102227123300022511SoilMWGMSWRQKAMKGVENCDKPGGVVKRASMPGFPNQPTLNP
Ga0242651_104792913300022511SoilGMSWRQEAMKGVEDCDKPRGAVTQALSPGYPNRPELNP
Ga0242667_103954713300022513SoilATKGVWGMSGRQEAMKGVEDCDNPGGAVNQALRPGSLN
Ga0242659_102703223300022522SoilMWGMSRRQEAMKGVEDCDKPGGLVKRELIPGYPNYHVLNS
Ga0242659_102785723300022522SoilMSRRQETMKGVEDCDKPGGAVKRALMPGYPNWRVLNP
Ga0242659_103950523300022522SoilVWGMSGRQEAMKGVEDCDNLGGAVNRALRPRSLNDCTLNP
Ga0242659_107571913300022522SoilTKGMWGMSWRQEAMKGVEDCDKPGEAVKRALIPGFPNERVLNP
Ga0242663_100326713300022523SoilKGVWGMSGRQKAMKGAEDCDKPGEAVKRALRPGSPNHQPPNP
Ga0242663_106319313300022523SoilTKGTWGMSWRQEAMKGVEDCDKPGEAVKQALIPGSLNAPELNP
Ga0242663_107799623300022523SoilVWGMSGRQEAMKGVEDCDNLGGAVNRALRPRSLNYCTLNP
Ga0242663_108735423300022523SoilVWGMSWRQKAMKGVEGCDKLGEAVKQALIPRSLNYRAPNP
Ga0242664_108207323300022527SoilVWGMSRRQEAKKGVEDCDKPGGLVKRDLIPGYPNDPTLNS
Ga0242669_111198813300022528SoilATKGMWGMSWRQKAMKGVEDCDKPGGTVKRVLIPGSLN
Ga0242668_109760023300022529SoilATKGVWGMSWRQEATKGVEDCDKPGEAVKRALIPGCPNQRTLNP
Ga0242658_102122723300022530SoilVWGMSWRQKAMKGVEGCEKPGEAVKRALIPGFPNVVH
Ga0242658_113665713300022530SoilTKGVWGMPWRQEAMKGVEDCDKLGGLVKRELIPRSLN
Ga0242658_114980223300022530SoilSWRQEAMKGVEDCDKPGGAVNRALRPGSLNQHVPNP
Ga0242658_117814823300022530SoilGVWGMSRRQEAMKGVEDCDKPGGLVKRELIPAQKSQH
Ga0242660_104825823300022531SoilGVWGMSWRQEAMKGVEDCEKPGGAVKRALRPGYPN
Ga0242660_106010913300022531SoilWGMSWRKEAMKGVDDCDKPGGAVNQALSPGSLNQPSLNP
Ga0242660_110504333300022531SoilWGMPRRQQAKKGVEDCDKLGGLVKRELIPRSLNHLHVNP
Ga0242660_121196423300022531SoilGVWGMSWRQEAKKGVENCDKPGEVVKRALIPGFPN
Ga0242655_1005746013300022532SoilKGVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGCPNYPALNP
Ga0242655_1018950223300022532SoilKGMWGMSWRQKAMKGVEDCDKLGEAVKRALIPRFPNWHELNP
Ga0242655_1022953613300022532SoilATKGMWGMSRRQEAKKGVEDCEKPGGAVKRALMPGCPNRLVLNP
Ga0242662_1021319223300022533SoilVWGMPWHQEAKKGVEDCDKPGGSVKRELIPGFLNDPAVNT
Ga0242670_101491613300022708SoilATKGMWGMSWRQEAKTGVEGCEKPGEAVKRALIPGFPNYLALNQ
Ga0242670_101809523300022708SoilVWGMSWRQEAMKGVEGCEKPGEAVKQALIPGFPNVVR
Ga0242670_102926523300022708SoilSRRQKAMKGVEDCDKPGEAVKRALIPGFPNDRVLNP
Ga0242674_105196023300022711SoilMSWRQEALKGVEDCEKLGGIVKRVLIPRYPNWHALNS
Ga0242653_101258433300022712SoilMYWRQRAMKGVEGCDKLGEAVKQALIPGFPNDRAPNP
Ga0242677_101049823300022713SoilVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGFPNVAY
Ga0242677_106254523300022713SoilMSRRQKAKKGVEDCEKPGGAVKRALMPGYPNRQALNP
Ga0242673_103091323300022716SoilVWGMSWRQEAMKGVEDCDKPGGAVNRALRPGYPNEHVLNP
Ga0242673_103117513300022716SoilATKGMWGMTWRQLAMKGVEDCDKPGEAVTRALNPGFPNQYALNL
Ga0242673_106125913300022716SoilKGVWGMSRRQEAMKGVEDCDKPGGAVKQALIPGCPN
Ga0242661_100879713300022717SoilKGVWGMAWLHEAMKGVDDCDNPGGAVNRALRPGSLH
Ga0242661_102706623300022717SoilGMPWRQEAMKGVEDCDKPGELVKRELIPGFPNCSGVNP
Ga0242661_102712933300022717SoilWGMSGRQKAMKGAEDCDKSGEAVKRALIPEYPNWHVLNS
Ga0242661_103498123300022717SoilMSWRQEAMKGVEDCDKPGGAVKRALIPGSLNYRTLNP
Ga0242661_105509523300022717SoilKGVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGSLN
Ga0242661_105931223300022717SoilWRQEAMKGVEDCDKPGETVKRVLIPGFPNGRTLNP
Ga0242661_108526913300022717SoilGMSWRQEAMKGVEDCDKPGEAVKRALIPGSLNQRTLNP
Ga0242661_115249423300022717SoilKGMWGMSWRQEAMKGVEDCDKLGEAVKRALIPRFPNDVN
Ga0242661_115742613300022717SoilTKGTWGMSRRQKAKKGVEDCDNPGGAVKRALIPGSLN
Ga0242675_100430723300022718SoilMWGMSGRQEAMKGVEDCDKPGEAVKRAMIPGSLNEQRLNP
Ga0242675_102044723300022718SoilWGMPWRQEAKKGVADCEKLGGLVKRELIPRSLTYLRVNP
Ga0242672_102507913300022720SoilKCVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNYPTLNP
Ga0242672_103748213300022720SoilGMWGMSWRQEAIKGVEDCEKPGVVVNRALIPGFPNYRALNP
Ga0242657_115432923300022722SoilMSWRQEALKGVEDCEKLGGIVKRVLIPRFPNWHALNS
Ga0242657_122830413300022722SoilKGMWGISWRQEAMKGVEDCDKPGEAVKQALIPGFPNDRSVNP
Ga0242665_1006600323300022724SoilMSGRQEAKKGVEDCDKPGGMVKRVLIPGSLNQRALNP
Ga0242665_1035758813300022724SoilGRWGMSGRQKAMKGAEDCDKPGGAVKRALRPGSLNDLVIFG
Ga0242654_1015230013300022726SoilQATKGVWGMSGRREAMKGVEDCDKPGEAVKRALRPGFPNQHALNP
Ga0242654_1026033423300022726SoilMWGMSWRQEAMKGVEDCDKPGEAVKRALIPGYPNDRVVNP
Ga0242654_1026885623300022726SoilTKGVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNYPALNP
Ga0242654_1027296223300022726SoilTKGVWGMPWRQEAMKGVEDCDKPGELVKHELIPGFPNYSGVNP
Ga0242654_1027559513300022726SoilKGMWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRSLNQPWLNP
Ga0242654_1029046723300022726SoilGMPRRQKAMKGVEDCDKPGGLVKRELIPGSLNQHHVNP
(restricted) Ga0233424_1000416653300023208FreshwaterVWGMPWRQEAMKGVEDCEKLGGLVKRELIPRSLNQPDVNP
Ga0247542_10261313300023544SoilKGVWGMPWRQEAMKGVEDCDKLGGLVKRELIPRSLNYPRLNP
Ga0247547_10219623300023656SoilVWGMSWRQKAMKGVEGCDKLGEAVKQALIPGFPNDRAPNP
Ga0232123_105341023300023706Salt MarshVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNYCMLNT
Ga0256352_104315623300024532FreshwaterVWGMSWHQKTKKGAENCDKPGGVVKQALIPGFLNKLTLNT
Ga0209172_1011685223300025310Hot Spring SedimentVWGMPRRQEAMKGVEDCDKPGGLVKRELIPGCPNQRGVNS
Ga0209323_1071313923300025314SoilVWGMSRRQEATKGVEGCDKPGEAAKRALIPGFPNDRMLNP
Ga0208005_117266123300025848AqueousVWGMSWRQKAMKGVEGCEKPGGAVKRALILGSLNYCSLNT
Ga0207694_10001965103300025924Corn RhizosphereVRRISRRQEAMKGVEDCDMPGEAVKRALIPGFLNYCMLNS
Ga0207668_1139913123300025972Switchgrass RhizosphereVWGMSWRQKAMKGVEDCDKPGVAVNRALIPGFPNDRALNP
Ga0209848_101831923300026221Permafrost SoilVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNYLHVNP
Ga0209805_115220723300026542SoilVWGMSWRQEAKKGVEDCDKPGEMVKRVLIPGYPNWHPVNP
Ga0209805_118315023300026542SoilVWGMSRRQQAKKGVEDCDKPGGAVKRALIPGCPNDRALNP
Ga0179587_1081340723300026557Vadose Zone SoilVWGMSWRQEAMKGVEDCDKPGGTVKRVLIPGFPNEYTLNP
Ga0256311_102843023300026565FreshwaterVWRMSRRQEAMKGVEGCEKPGVAVKQAIIPGFPNYHVLNP
Ga0207855_103226923300027039Tropical Forest SoilVWGMSWRQEAMKGVEDCDKPGEAVKRALMPGFPNECTLNP
Ga0208042_100896423300027568Peatlands SoilVWGMSWRQEAMKGAEDCDKSGGAVKRALIPEFPNYHGLNP
Ga0207826_122583723300027680Tropical Forest SoilMSWRQEALKGVEDCDKPGVVVKRALIPGYPNWRTLNP
Ga0208991_104514923300027681Forest SoilVWGMPRRQEAMKGVEDCDKLGGLVKRELIPRSLNQHGVNP
Ga0209390_1001018523300027848FreshwaterVWGMSWRQKAMKGVEGCDKPGGAVKRALIPGYPNYRRLNT
Ga0209591_1043336523300027850FreshwaterVWGMSWHQKAMKGVEGCDKPGEAVKRALIPGFPNDRSLNT
Ga0209168_1060190923300027986Surface SoilMWGMSRRQEAMKGVEDCDKPGGLVKRDLIPGFPNDPVLNS
Ga0256323_102615813300028077FreshwaterIHKGVWGMSWRQKAMKGVEGCEKLGEAVKQALIPGFPNYRMLNT
Ga0256305_101131333300028108FreshwaterWGMSWRQKAMKGVEGCEKLGEAVKQALIPGFPNYRMLNT
Ga0247822_1028467523300028592SoilMSWLQEALKGVEDCDKPGVFVKRKLIPGFPNRPAMNT
Ga0257140_102891723300028668MarineMSRRQESTKGVVGCDKLREAVKRALIRRSPNHLLLNS
(restricted) Ga0247842_1012270023300029268FreshwaterVWRMSRCQEAMKGVEDCEKPGEAVKRALIPGFLNYCMLNS
Ga0206094_11001713300029659SoilKGVWGMPWRHEALKGVADCDKPGGMVKRVLIPGFPN
Ga0299907_1098378723300030006SoilMSWRQKAMKGVEGCEKPGEAVKRALIPGFPNARVLNP
Ga0302179_1032570423300030058PalsaVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNVVR
Ga0210273_115069623300030525SoilMWGMSRRQKAKKGVEDCEKPGGAVKQALTPGYPNRRTLNP
Ga0210277_1037727723300030528SoilVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNYLRVNP
Ga0210277_1052501713300030528SoilGQATKGVWGMPWRQEAMKGVEDCDKLGGLVKRELIPRSLNYPRLNP
Ga0210290_120060113300030532SoilQCGQATKGVWGMSGRQEAMKGVEDCDNPGGAVNRALRPGSLN
Ga0247642_102452613300030537SoilGTWRMSWRQKAMKDVEGCDKPGRAAKQALKPGSPN
Ga0247649_105037923300030540SoilSWRQKAMKGVEGCEKPGRAAKQALKPGYPNDRALNS
Ga0247649_109391313300030540SoilGQATKGVWRMSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT
Ga0210289_132029413300030543SoilQATKGMWGMSWRQKAMKGVEDCDKPGGTVKRVLIPGSLN
Ga0210271_1088684813300030545SoilGQATKSMWGMSWRQKAMKGVEDCDKPGEAVKRAMIPGSLN
Ga0247640_110778913300030554SoilATKGMWGMSWRQEAKKGVEDCDKPGEAVKRASIPGSLNYHNLNP
Ga0210256_1032668623300030564SoilVWGMSWRQEAMKGVEDCEKPGGAVKRVLMPGCPNRRVLNP
Ga0247628_112430623300030569SoilVRGMSWRQEAMKGVEDCENPGGAVKRASMPGSPNQHALNP
Ga0247647_116960413300030570SoilTWGMSWRQEALKGVEDCEKLGGIVKRVLIPRFPNWHTLNP
Ga0247658_114241613300030584SoilGQVTKGIRGMSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT
Ga0210255_1018365913300030589SoilRMSRRQDAMKGVEDCDKPGEAVKRALIPGFLNYRILNS
Ga0210278_104835023300030596SoilLWRMSRRQEAMKGVEDCDKPGEAVKRALIPGFLNYCMLNS
Ga0210287_109065413300030598SoilQATKGMWGMSWRQKAMKGVEDCDKPGGAVNRALRPGCPN
Ga0247659_122695013300030600SoilRGMSRRQKAMKGVEGCDKLGEAVKQALIPRYPNHSMLNT
Ga0210254_1049086023300030602SoilVWGMSRRQEAKKGVEDCEKPGGAVKQALRPGYPKCVS
Ga0247637_120043313300030604SoilGMWGMSGRQEATKGVEDCDNPGGAVKRALRPGSPNHPVLNP
Ga0210265_113065023300030605SoilVWGMSRRQEAKKGVEDCDKPGGLVKRELIPGYPNDPALNS
Ga0247615_1037416613300030607SoilGAWGMSWRQKTMTGVEDCEKPGEAVKQALIPGYPNKLLLNP
Ga0210251_1108003113300030624SoilGVWGMSRRQEAKKGVEDCDKPGGLVKRELIPGSLNYPALNP
Ga0210268_122176623300030629SoilMSWRQEALKGVENCEKLGGTVKRVLSPRFPNWSALNP
Ga0247623_1002853523300030633SoilVWGMSWRQKAMKGVEGCDKSGEAVKRALIPESLNYR
Ga0247623_1032563313300030633SoilQVTKGIRGMSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT
Ga0247627_1018463723300030635SoilVDPGGQATKGVWGMPWRQEAMKGVEDCDKPGGMVKRVLIPGSPNYRRLNP
Ga0247617_114991913300030684SoilVTKGIRGMSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT
Ga0265460_1096029713300030740SoilQANKGMWRMSRRQEAMKGVEDCEKPGEAVKQALIPGFPNYLMLNP
Ga0265460_1296643723300030740SoilVWGMSWRQEAKKGVEDCEKPGGAVKRALIPGYPNRHALNP
Ga0265459_1097950623300030741SoilMWGMSRRQEAKKGVEDCEKPGGAVKQALMPGCPNWSALNP
Ga0265459_1325595123300030741SoilVWGMSRRQEAKKGVEDCDKPGGLVKRELIPGYPNYRTLNS
Ga0102764_194209313300030751SoilWRQEAMKGVEDCDKLGGLVKRELIPRSLNQRVVNP
Ga0138305_155916723300030758SoilGGQANKGVWRMSRRQEAMKGVEGCEKPGVAVKQALIPGFLNYHVLNP
Ga0265762_106817013300030760SoilWGMSWRQKAMKGVEGCDKLGEAVKQALIPGFPNDRAPNPYVHEANAVT
Ga0265763_103176713300030763SoilKSMWGMSRRQEAMKGVDDCDKPGGLVKRELIPGSLNYHGVNP
Ga0074007_1015254323300030774SoilVWGMSWHQKAKKGVEDCEKPGGAVKRALNPGCPNQPALNA
Ga0075402_1013721723300030777SoilVWGMSRRQEARKGVEDCDKPGGAVKRALIPGSPNGRTLNP
Ga0075402_1231993423300030777SoilVWGMSWHQKAKKGVEDCEKPGGAVKRAMNPGYPNQPALNA
Ga0075402_1247828023300030777SoilMWGMSWRQKAMKGVADCDKLGGTVKRVLIPRYPNAMY
Ga0075398_1005319323300030778SoilVWGMSRRQEARKGVEDCDKPGGAVKRALIPGFPNGPTLNP
Ga0075398_1221836023300030778SoilVWGMSWRQEAKKGVEDCDKPGGAVNRALRPGCPNCRVLNP
Ga0102754_105988923300030782SoilVWGMSRRQEAMKGAENCEKPGGAVKQALMPGYPNGRKLNP
Ga0102752_103033623300030783SoilMSWCQEAMKDAVGCDNPGRAANRALKPGSPNDRALNP
Ga0102758_1008800413300030784SoilMSWRQEAMKGVEDCDKLGEVVKQALIPRYPNYHALNP
Ga0138304_102696423300030790SoilVWGMPRHQEAKKGVEDCDNPGEAVKRALIPGSLNHPALNP
Ga0308203_103576213300030829SoilTKGVWGMSRRQEAMKGVEDCEKPGGAVKRALRPGSLNQRALNA
Ga0308205_102109623300030830SoilRRQEAMKGVEDCEKPGGAVKRALRPGSLNQRALTA
Ga0308152_11207213300030831SoilWRQEAKKGVEDCDNPGGAVKRALIPWCPNYPALNP
Ga0073999_1013510823300030839SoilVWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRSLNVPSLNP
Ga0075392_1006582223300030843SoilMWGMSWRQKAMKGVEDCEKPGEAVKRALIPGSLNQRRLNP
Ga0075397_1005453023300030845SoilMWGMSWRRQAMKGVEDCDKSGGAVKRALMPEYPNRRVLNP
Ga0075388_1009247423300030848SoilVWGMSRRQEARKGVEDCDKPGGAVKRAMIPGFPNEPTLNP
Ga0075393_1008539923300030849SoilVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNYPTLNP
Ga0075389_1006814223300030852SoilVWGMSRRQKAKKGVEDCEKPGGAVKRALRPGYPNERELNP
Ga0075385_1004941313300030854SoilQATKGMWGMSWRRQAMKGVEDCDKSGGAVKRALMPEFPNQCTLNP
Ga0075374_1007706623300030855SoilMWGMSWRQEATKGVEDCEKPGGAVKRALKPGYPNRRVLNP
Ga0075374_1009110423300030855SoilLGQRGQATKGVWGMPWHQEAMKGVEDCDKPGGSVKRESIPGSLNYPGVNP
Ga0075374_1012912423300030855SoilVWGMSWRRQATKGVEDCDKSGGAVKRALMPEYPNRCTLNP
Ga0102759_102778013300030858SoilAGAWGMSWRQEAMKGVEDCDKPGEVVKQALIPRYPNYHALNP
Ga0102759_197351523300030858SoilATKGVWGMSRRQEATKGVEDCDKPGGAVKRALIPGCPNYRVLNP
Ga0102759_197602623300030858SoilVWGMSWRQEAMKGVEDCEKPGGMVKRVLIPGSLNERGVNT
Ga0102749_100210223300030867SoilKGMWGMSWRQKAMKGVADCDKLGETVKRVLIPRYPNAVY
Ga0102749_100969423300030867SoilMSGRPEAMKGVEDCEKPGGAVKRALIPGFPNDRTLNP
Ga0102749_102745323300030867SoilMSWRQEAMKGVEDCDKLGGVVKQALIPRYPNYHALNP
Ga0265776_10797723300030880SoilATKGMWGMSRRQEAMKGVEDCDKPGEAVKRALIPGSLN
Ga0265776_11021013300030880SoilTKGVWGMSWRQEATKGVEDCEKPGEAVKRALIPGYPN
Ga0265772_10175323300030886SoilMWGMSWRQQAMKGVEDCEKPGGMVKRVLIPGYPNERALNP
Ga0308198_109946923300030904SoilMWGMSWRQEAMKGVEDCEKPGGMVKRVLIPGSLNERVLNP
Ga0075382_1004182623300030917SoilMSWRQKAKKGVEDCEKPGGAVKRALIPGSLNQSRLNP
Ga0075382_1005234223300030917SoilMWGMSWHRQAMKGVEDCDKSGEAVKRALIPEYPNRRILNP
Ga0075382_1010656823300030917SoilMWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRYPNEHVLNP
Ga0075382_1012004423300030917SoilVWGMSWRQKAMKGVENCDKPGEVVKRALIPGYPNERALNP
Ga0102762_104502623300030920SoilVWRISRCQEAMKGVEDCDKPGEAVKRALIPGFLNYCILNS
Ga0138296_179242913300030923SoilGQATKGMWGMSWRQEATKGVEDCDKPGGAVKRALSPGCPNQHALNP
Ga0138306_144234913300030936SoilGQATKGVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGSLNHRGMNP
Ga0138306_159797233300030936SoilGQATKGVWGMSGRQEAMKGVEDCDNPGGAVNRALRPGSLNYRKLNP
Ga0138303_111160013300030939SoilATKGVWGMSWRQEAMKGVEDCEKPGGAVKRALMPGCPNRRVLNP
Ga0138303_128055523300030939SoilMWGMSWRQKAMKGVEDCDKPGEVVKRTLIPGFPNMPTLNP
Ga0138303_140931923300030939SoilQATKGMWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRYPNEHVLNP
Ga0138303_146750123300030939SoilMWRMSRRQEAMKGVEGCEKPGVAVKQALIPGSPNYLMLNP
Ga0138303_147934313300030939SoilQANKGVWRMSRRQEAMKGVEDCEKPGVAVKQALIPGFPNYLMLNP
Ga0247549_10038523300030942SoilVTKGVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGCPNDRTLNP
Ga0075373_1166253423300030945SoilMWGMSWHRQAMKGVEDCDKSGGAVKRALRPEYPNRYVLNP
Ga0075390_1002228923300030947SoilVWGMSWRQEATKGAEDCDKSGGAVKRALIPEFPNYHALNP
Ga0074034_1005272523300030950SoilMSRRQKAKKGVEDCEKPGGAVKRALMPGYPNRRTLNP
Ga0074034_1005366223300030950SoilVWGMSWRQEAMKGVEDCDKPGEAVKRASMPGFPNWRVLNP
Ga0102745_102990913300030960SoilWRQEAMKGVEDCDKLGEVVKQALIPRYPNYHALNS
Ga0102745_104549123300030960SoilVWGMSWRQKAKKGVENCEKPGGAVKRAMSPGCPNQPPLNA
Ga0102745_180052913300030960SoilWGMSWRQKAMTGVEDCENFGVAVKQALIPKFPNQFILNP
Ga0265768_10178723300030963SoilVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGFPNVAR
Ga0075394_1015283223300030969SoilMWGMSRRQKAKKGVEDCDNLGGAVKRALIPRSLNQPALNP
Ga0075381_1010489823300030970SoilMWGMSWRQKAMKGVEDCDKLGGVVKRTLIPRSLNEPALNP
Ga0075381_1012103823300030970SoilVWGMSWRQEAMKGVEDCDKRGGAVKRALIPRSLNDPALNP
Ga0075381_1015674413300030970SoilQEAKKGVEDCDKPGEAVKRALIPGYPNQQEREEEQ
Ga0075395_1002851623300030973SoilMSWRQKALKGVENCDKPGVIVKQVLIPGFPNWPAPNP
Ga0075395_1004757223300030973SoilMWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGSLNERVLNS
Ga0075371_1002373423300030974SoilVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNYHGVNP
Ga0099845_104568523300030975Boreal Forest SoilVWGMSRRQEAKKGVEDCDKPGGLVKRELIPGFPNHLTLNP
Ga0102770_1002753323300030981SoilVWGMSRRQEAMKGVEDCEKLGVAVKRALNPRYPNEPDLNP
Ga0102770_1002814823300030981SoilMWGMSWRQEAMKGVEDCEKPGGAVKRALIPGYPNDPALNP
Ga0265748_10074023300030982SoilGMPRRQKAKKGVEDCDKPGGLVKRELIPGSLNYLAVNP
Ga0308154_10589813300030986SoilKGVSGMPRRQDAMKGEEDSDNPGGAVNRALRPGCPNQPVPNP
Ga0308178_103363523300030990SoilVWGMSWRQEATKGAEDCDKPGRAVKQALTPGSPNYPALNP
Ga0073997_1010629823300030997SoilVWGMSWRQKAMKGVEGCEKPGEAVKRALIPGYPNDRTLNP
Ga0265774_10357513300031011SoilKGMWGMSWRQEAKKGVEDCDKPGGAVKQALIPGCPNERALNS
Ga0102753_101965823300031013SoilVWGMSWRWKAMKGVEDCDKPGGSVKRELIPGYPNYRALNP
Ga0138298_137315313300031015SoilATKGVWGMPWHQEAMKGVEDCDKPGGSVKRELIPGSLNYPLANP
Ga0138298_173450623300031015SoilMWGMSRRQKAKKGVEDCDKPGGAVKRALIPGYPNWRTLNP
Ga0265732_10386813300031016SoilATKGVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGSLNDTH
Ga0265773_101004523300031018SoilVWGMSWRQEAMKGVEDCEKPGGAVKRALRPGYPNWQALNP
Ga0102765_1014103723300031021SoilVWGMSWHQKAKKGVEDCEKPGGAVKRALNPGYPNQPALNA
Ga0138301_113052323300031022SoilVWGMPWRQEAMKGVEDCDKPGEAVKRALIPGSLNWRTLNP
Ga0138301_116988423300031022SoilVWGMSWRQEATKGAEDCDKLGGAVKRALIPRFPNHHALNP
Ga0138301_164691713300031022SoilQCGQATKGVWGMSGRQEAMKGVEDCDNPGGAVNQALRPGSLN
Ga0073998_1008668123300031023SoilMSWRQEAMKGVENCDKPGGMVKRVLIPGFPNWPGLNP
Ga0102760_1000706723300031039SoilGMSWRQEALKGVEDCEKLGGIVKRVLIPRFPNRHALNS
Ga0265755_10815413300031041SoilKGMWGMSRRQEAMKGVEDCYKPGGAVKRALIPGSLN
Ga0265749_10408613300031042SoilKGVWGMPWRQEAMKRVEDCDKPGELVKRELIPGFPNYLGVNP
Ga0073995_1005861323300031047SoilVWGMPRRQKAMKGVEDCDKPGGLVKRELIPGSLNYL
Ga0073995_1007986523300031047SoilVWGMSRRQKAKKGVEDCEKPGGAVKRALRPGYPNERVLNP
Ga0074018_178807723300031053SoilMWGMSWRQEAMKGVEDCDKPGGAVKRALRPGFPNQRTLNP
Ga0102746_1003621023300031054SoilMSWRQEALKGVEDCEKLGVVVKRTLIPRFPNCHTLNP
Ga0102746_1003828823300031054SoilVWGMPWRQEAMKGVEDCDKPGGTVKRVLIPGYPNYSRANP
Ga0102746_1006967223300031054SoilVWGMSWRQEATKGVEDCDKLGGAVKRALIPRSLNYPGLNP
Ga0102746_1007277923300031054SoilVWGMPWRQKAMKGVEDCDKPGGLVKRELIPGSLNQLRVNP
Ga0102746_1008863223300031054SoilVWGMSRRQEAMKGVEDCDKPGGAVKRALMPGCPNWPALNA
Ga0102751_139502223300031055SoilKGVWGMSRRQEAMKGVEGCEKPGGAVKRALRPGSLNQRTLNP
Ga0170834_10377964223300031057Forest SoilVWRMPWHQEAMKGVEDCDKPGGSVKRELIPGSLNDSRVNP
Ga0170834_10826079233300031057Forest SoilTKGMWGMSWRQEAMKGVEDCDKPGEMVKRVLIPGYPNQRMLNP
Ga0308192_103265813300031082SoilGVWGMSRRQEAMKGAAGCDKPGGAVNEALRPGFPNYRVLNP
Ga0102748_1006341123300031089SoilVWGMSGRQEAMKGVEDCDNLGGAVNRALRPRSLNNCTLNP
Ga0102748_1010377523300031089SoilSWRQEATKGVEDCDKLGEVVKQALIPRYPNYHALNP
Ga0308201_1025942523300031091SoilVWGMSWRQKAKGQDCDKSGGAVKRALIPECPSEPRELKHL
Ga0308199_110915313300031094SoilATKGVWGMPWRQKAMKGVEDCEKPGGLVKRELIPGSLN
Ga0308193_106308823300031096SoilVWGMSWRQEAKKGVQDCDKPGEVVKRALIPGYPNERALNP
Ga0308188_102689323300031097SoilMPWCQEAMKGVENCDKLGEAVKQALIPRFPNDRALNT
Ga0308187_1016392023300031114SoilKGVWGMSGRQQAKKGVQDCEKPGGAVNQALRPGCPN
Ga0170822_1038966633300031122Forest SoilGQATKGMWGMSRRQEAKKGVEDCDKPGEAVKRALRPGFPNSRALNP
Ga0170822_1342820033300031122Forest SoilWGMSWRQEAMKGVEDCDKPGEMVKRVLIPGYPNQRMLNP
Ga0308195_104614923300031123SoilVWGMPWHQEAMKGVEDCDKLGGLVKRELIPRFPNDPGVNP
Ga0308151_102535523300031124SoilMWGMSWRWKAMKCVEDCEKLVEAVNQELIPRSLNAAY
Ga0308182_100739523300031125SoilVWGMPWRQEAMKGVEVCDKPGGLVKRELIPGSLNYSGVNP
Ga0170824_10087242023300031231Forest SoilVWRMPWHQEAMKGVEDCDKPGGSVKRELIPGSLNDPLVNP
Ga0170824_10170720523300031231Forest SoilVWGMSWRQEAKKGVEDCDKPGGAVKQALIPGSLNRRVLNP
Ga0170824_10275327323300031231Forest SoilMWGMSWRQEAKKGVEDCEKPGGAVKRASIPGYPNERDLNT
Ga0170824_11487689523300031231Forest SoilVWGMSWRQKAKKGVEGCEKPGEAVKQALIPGFPNVVR
Ga0170824_12571790323300031231Forest SoilWGMSWRQEAKKGVEDCEKPGGAVKRALRPGFPNGPVLNP
Ga0308179_100343113300031424SoilKGVWGMSWRQEAKKGVEDCEKPGGAVKRALRPGFPNGPVLNP
Ga0308179_101572613300031424SoilAHKGVWGMSWHQKAMKGVEGCDKPGEAVKRALIPGFPNDRTLNT
Ga0170820_1311406223300031446Forest SoilVWGMSWRQEAMKGVENCDKPGGAVKRALIPGSLNAAV
Ga0170820_1333262623300031446Forest SoilVWGMSRRQEAKKGVEDCEKSGGAVKRASIPECPNERVLNP
Ga0170820_1499599123300031446Forest SoilMSWLQEALKGVEDCDKLGVFVKRKLIPRFPNRPLMNT
Ga0170820_1650009623300031446Forest SoilVWGMPWRQEATKGVEDCDKPGEAVKRALIPGSLNWRVLNP
Ga0170820_1660035523300031446Forest SoilMWGMSWRQEAMKGVEDCDKPGGVVKRTLIPGYPNEP
Ga0170819_1031863223300031469Forest SoilMSWRQKAMKGVEDCDKPGGMVKRVLIPGSLNYHSLNP
Ga0170819_1615497423300031469Forest SoilMSWRQEASKGVEDCDKPGVIVKRVLIPGFPNQHALNQ
Ga0170819_1757357223300031469Forest SoilVWRMSRRQEAMKGVEGCDMPGVAVKQAMIPGFPNYHALNP
Ga0170819_1798476223300031469Forest SoilMWGMSWRQKAMKGVEDCDKLGGVVKRTLIPRSLNWPALNP
Ga0170818_10348128913300031474Forest SoilGMSWRQEALKGVEDCENLGGTVKRVLIPRYPNWQALNS
Ga0170818_10358877923300031474Forest SoilVWGMSWRQEATKGVEDCDKPGGAVKRALIPGSLNYRALNP
Ga0170818_10569213723300031474Forest SoilVWGMSGRQEAMKGVEDCDKPGETVKRVLIPGFPNECALNS
Ga0170818_10629092223300031474Forest SoilVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGFPNDRTLNP
Ga0170818_10658351723300031474Forest SoilGQANKGVWRMSRRQEAMKGVEGCEKPGVAVKQAMIPGFLNYLMLNP
Ga0314822_11086923300031484SoilMSWRQKAMKGVEDCEKLGGTVKQVMIPGFPNQRILNS
Ga0314818_11141413300031499SoilGARGMSWHQQAMKGVEGCDKPWGAVKQALIPGYPNQCILNP
Ga0310915_1037802523300031573SoilVWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGFPNERMLNP
Ga0310915_1070643533300031573SoilVWRMSWRQKAMKGVEGCEKPGEAVKQALIPGFPNDRAPNP
Ga0306925_1078835923300031890SoilMWGMSWRQEARKGAAGCDKPGGVVKRALIPGFPNHRTLNP
Ga0316039_11751313300031891SoilTKGVWGMSRRQEAMKGAAGCDKPGGAVNEALRPGFPNYRVLNP
Ga0306923_1114358523300031910SoilMWGMSWRRQAMKGVEDCDKSGEAVKRALMPEFPNQCTLNP
Ga0306923_1177838623300031910SoilVWGMPWHQEATKGVEDCDKPGGLVKRELIPGSLNQRAVNP
Ga0306921_1096734623300031912SoilMWGMSWRQEAMKGVEDCDKPGGAVKRALRPGSPNRPALNP
Ga0306926_1134248923300031954SoilMWGMSWRQKAMKGVEDCDKLGEAVKRALIPRFPNRCMLNP
Ga0316035_11034923300031955SoilGMWGMSWRQQAKKGVEDCEKPGEAVKRALIPGSLNQQRLNP
Ga0316032_10649913300031956SoilGVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNYHGVNPIAP
Ga0326597_1091126323300031965SoilMSWCQEAMKGVEDCDKPGEAVKRALIPGSLNERSLNS
Ga0306922_1190132823300032001SoilVWGMSWRQEARKGVEDCDKPGGAVKRALRPGSPNHRALNP
Ga0247536_10304923300032027SoilKGVWGMSGRQEATKGVEDCDNLGGAVNRALRPRSLNNHALNP
Ga0310911_1084329523300032035SoilVWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGCPNERMLNP
Ga0318532_1018214723300032051SoilVWGMSWRQEATKGAEDCDKSGGAVKRALIPGFPNHHALNP
Ga0318533_1063440423300032059SoilVWRMSWRQKAMKGVEGCEKLGGAVKQALIPGFPNDRAPNP
Ga0318533_1069788723300032059SoilVWGMSWRQKAMKGVEDCDKPGGAVKRVLIPGSLNERVLNP
Ga0316053_10309513300032120SoilATKGVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNHPRLNP
Ga0311301_1082987523300032160Peatlands SoilMWGMSWRQKARKGVEDCDKPGEAVKQALLPGFPNQPALNP
Ga0307471_10110937223300032180Hardwood Forest SoilVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNQPHVNPIA
Ga0306920_10017562113300032261SoilMPRRQKAMKGVEDCDKLGGLVKRELIPRSLNQHGVNP
Ga0306920_10167943223300032261SoilMWGMSWRQEAMKGVEDCEKPGGMVKRVLIPGFPNRRTLNS
Ga0306920_10181185023300032261SoilMWGMSWRQKAMKGVEDCEKPGVAVNRALIPGFPNYRALNP
Ga0306920_10207531023300032261SoilVWGMSWRQEATKGVEDCDKPGGIVKRVLIPGFPNQRPLNP
Ga0348332_1013377433300032515Plant LitterWRQKAKKGVEDCEKPGGAVNRALRPGYPNERTLNP
Ga0348332_1062244913300032515Plant LitterVTKGVWGMSRRQEAMKGVEDCDKPGGLVKRELIPGFPNDRTLNS
Ga0348332_1075099223300032515Plant LitterGMSRRQEAMKGVEDCDKPGGLVKRDLIPGYPNDPALNS
Ga0348332_1352063113300032515Plant LitterATKGMWGMSWRQKAKKGVENCDKPGEVVKRASIPGFPN
Ga0348332_1413592013300032515Plant LitterTKGVWGMSWRQEAMKGAENCDKSGGAVKRALIPEFPNHHALNP
Ga0315742_1303953823300032756Forest SoilMWGMSRRQEAKKGVEDCEKPGGAVKQALMPGYPNWSALNP
Ga0335075_1158988923300032896SoilVWGMSWRQEAMKGVEDCDNPGGAVNRALRPGSLNYCTLNP
Ga0314801_185118_2_1543300034676SoilATKGVWGMPWRQEAKKGAEDCDKPGGLVKRELIPGHQRTNRLWHLADGLA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.