Basic Information | |
---|---|
Family ID | F001679 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 653 |
Average Sequence Length | 40 residues |
Representative Sequence | VWGMSWRQEAMKGVEDCDKPGEAVKRALIPGCPNYRALNP |
Number of Associated Samples | 445 |
Number of Associated Scaffolds | 653 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 8.88 % |
% of genes near scaffold ends (potentially truncated) | 34.61 % |
% of genes from short scaffolds (< 2000 bps) | 96.78 % |
Associated GOLD sequencing projects | 436 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.263 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.600 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.412 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.176 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.41% β-sheet: 0.00% Coil/Unstructured: 70.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 653 Family Scaffolds |
---|---|---|
PF00483 | NTP_transferase | 0.31 |
PF08762 | CRPV_capsid | 0.15 |
PF00120 | Gln-synt_C | 0.15 |
PF05635 | 23S_rRNA_IVP | 0.15 |
PF13432 | TPR_16 | 0.15 |
PF06186 | DUF992 | 0.15 |
PF02446 | Glyco_hydro_77 | 0.15 |
PF08281 | Sigma70_r4_2 | 0.15 |
PF00127 | Copper-bind | 0.15 |
PF00700 | Flagellin_C | 0.15 |
PF02910 | Succ_DH_flav_C | 0.15 |
PF04542 | Sigma70_r2 | 0.15 |
PF16576 | HlyD_D23 | 0.15 |
PF02201 | SWIB | 0.15 |
PF00027 | cNMP_binding | 0.15 |
PF16363 | GDP_Man_Dehyd | 0.15 |
PF00889 | EF_TS | 0.15 |
PF00011 | HSP20 | 0.15 |
PF12623 | Hen1_L | 0.15 |
PF04896 | AmoC | 0.15 |
PF00012 | HSP70 | 0.15 |
PF00253 | Ribosomal_S14 | 0.15 |
PF14279 | HNH_5 | 0.15 |
PF13581 | HATPase_c_2 | 0.15 |
PF00620 | RhoGAP | 0.15 |
PF13361 | UvrD_C | 0.15 |
PF01159 | Ribosomal_L6e | 0.15 |
PF02776 | TPP_enzyme_N | 0.15 |
PF09861 | Lar_N | 0.15 |
PF00158 | Sigma54_activat | 0.15 |
PF07642 | BBP2 | 0.15 |
PF01781 | Ribosomal_L38e | 0.15 |
PF01799 | Fer2_2 | 0.15 |
PF02082 | Rrf2 | 0.15 |
PF12551 | PHBC_N | 0.15 |
PF00254 | FKBP_C | 0.15 |
PF02416 | TatA_B_E | 0.15 |
PF10431 | ClpB_D2-small | 0.15 |
PF02874 | ATP-synt_ab_N | 0.15 |
PF00171 | Aldedh | 0.15 |
PF07517 | SecA_DEAD | 0.15 |
PF02171 | Piwi | 0.15 |
PF00112 | Peptidase_C1 | 0.15 |
PF05047 | L51_S25_CI-B8 | 0.15 |
PF08543 | Phos_pyr_kin | 0.15 |
COG ID | Name | Functional Category | % Frequency in 653 Family Scaffolds |
---|---|---|---|
COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.15 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.15 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.15 |
COG0199 | Ribosomal protein S14 | Translation, ribosomal structure and biogenesis [J] | 0.15 |
COG0264 | Translation elongation factor EF-Ts | Translation, ribosomal structure and biogenesis [J] | 0.15 |
COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.15 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.15 |
COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.15 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.15 |
COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.15 |
COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.15 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.15 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.15 |
COG1344 | Flagellin and related hook-associated protein FlgL | Cell motility [N] | 0.15 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.15 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.15 |
COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.15 |
COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.15 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.15 |
COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.15 |
COG2163 | Ribosomal protein L14E/L6E/L27E | Translation, ribosomal structure and biogenesis [J] | 0.15 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.15 |
COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.15 |
COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.15 |
COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.15 |
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.15 |
COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.15 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.15 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.15 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.95 % |
Unclassified | root | N/A | 22.05 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2077657000|ZODLETONE_B1_GLDH0LQ01AET48 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 555 | Open in IMG/M |
2077657000|ZODLETONE_B1_GLDH0LQ01B64DD | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 539 | Open in IMG/M |
2077657000|ZODLETONE_B1_GLDH0LQ01BMN8B | Not Available | 568 | Open in IMG/M |
2077657000|ZODLETONE_B1_GLDH0LQ01BPG9Q | Not Available | 554 | Open in IMG/M |
3300000336|thermBogB3DRAFT_101267 | Not Available | 506 | Open in IMG/M |
3300004471|Ga0068965_1060341 | Not Available | 526 | Open in IMG/M |
3300004629|Ga0008092_10026415 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005454|Ga0066687_10548845 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 686 | Open in IMG/M |
3300006047|Ga0075024_100048784 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1765 | Open in IMG/M |
3300006047|Ga0075024_100846373 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 516 | Open in IMG/M |
3300006050|Ga0075028_100103898 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1453 | Open in IMG/M |
3300006111|Ga0007848_1074600 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 632 | Open in IMG/M |
3300006126|Ga0007855_1135236 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 509 | Open in IMG/M |
3300006172|Ga0075018_10113527 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1215 | Open in IMG/M |
3300006175|Ga0070712_101836345 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 531 | Open in IMG/M |
3300006355|Ga0075501_1059133 | Not Available | 1188 | Open in IMG/M |
3300006355|Ga0075501_1074875 | Not Available | 776 | Open in IMG/M |
3300006357|Ga0075502_1718915 | Not Available | 712 | Open in IMG/M |
3300006364|Ga0075482_1032660 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300006373|Ga0075483_1025427 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300006373|Ga0075483_1050817 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 557 | Open in IMG/M |
3300006373|Ga0075483_1070077 | Not Available | 2065 | Open in IMG/M |
3300006378|Ga0075498_1114004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1041 | Open in IMG/M |
3300006378|Ga0075498_1119908 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 563 | Open in IMG/M |
3300006394|Ga0075492_1000784 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 679 | Open in IMG/M |
3300006569|Ga0075500_129092 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300006638|Ga0075522_10354940 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300006691|Ga0031679_1006301 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300006712|Ga0031693_1009120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldalkalibacillus → Caldalkalibacillus thermarum → Caldalkalibacillus thermarum TA2.A1 | 2230 | Open in IMG/M |
3300006791|Ga0066653_10434796 | Not Available | 670 | Open in IMG/M |
3300006796|Ga0066665_10713069 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300006800|Ga0066660_10897733 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 721 | Open in IMG/M |
3300006800|Ga0066660_10997658 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300006800|Ga0066660_11684638 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 505 | Open in IMG/M |
3300006844|Ga0075428_100298394 | Not Available | 1732 | Open in IMG/M |
3300006860|Ga0063829_1029223 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 720 | Open in IMG/M |
3300006861|Ga0063777_1033349 | Not Available | 732 | Open in IMG/M |
3300006861|Ga0063777_1038729 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 818 | Open in IMG/M |
3300006865|Ga0073934_10421770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 815 | Open in IMG/M |
3300006893|Ga0073928_11085047 | Not Available | 542 | Open in IMG/M |
3300006904|Ga0075424_101140016 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 831 | Open in IMG/M |
3300006934|Ga0080680_1052666 | Not Available | 1012 | Open in IMG/M |
3300006934|Ga0080680_1068687 | Not Available | 579 | Open in IMG/M |
3300006935|Ga0081246_1055890 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300006937|Ga0081243_1078196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5 | 859 | Open in IMG/M |
3300006937|Ga0081243_1093734 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 682 | Open in IMG/M |
3300006938|Ga0081245_1040377 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300006938|Ga0081245_1068838 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 705 | Open in IMG/M |
3300006939|Ga0081244_1035728 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 699 | Open in IMG/M |
3300006939|Ga0081244_1072209 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 654 | Open in IMG/M |
3300007519|Ga0105055_10011279 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 11049 | Open in IMG/M |
3300007521|Ga0105044_10700087 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 825 | Open in IMG/M |
3300007544|Ga0102861_1165923 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300007860|Ga0105735_1038738 | Not Available | 917 | Open in IMG/M |
3300008559|Ga0103605_1004974 | Not Available | 817 | Open in IMG/M |
3300008578|Ga0103649_100232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 664 | Open in IMG/M |
3300008584|Ga0103655_100211 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300008590|Ga0103643_100990 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 505 | Open in IMG/M |
3300008592|Ga0103654_100389 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300008655|Ga0103645_100823 | Not Available | 513 | Open in IMG/M |
3300008661|Ga0103653_100662 | Not Available | 578 | Open in IMG/M |
3300008661|Ga0103653_101125 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 509 | Open in IMG/M |
3300008785|Ga0103638_1000444 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 878 | Open in IMG/M |
3300009032|Ga0105048_10034414 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 7465 | Open in IMG/M |
3300009032|Ga0105048_10132592 | Not Available | 3182 | Open in IMG/M |
3300009038|Ga0099829_10469932 | Not Available | 1043 | Open in IMG/M |
3300009075|Ga0105090_10301855 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 981 | Open in IMG/M |
3300009088|Ga0099830_11362841 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 590 | Open in IMG/M |
3300009089|Ga0099828_11212992 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 669 | Open in IMG/M |
3300009095|Ga0079224_101429438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 982 | Open in IMG/M |
3300009129|Ga0118728_1040138 | Not Available | 2561 | Open in IMG/M |
3300009137|Ga0066709_102664786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
3300009143|Ga0099792_10687623 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300009199|Ga0103748_10016642 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1120 | Open in IMG/M |
3300009199|Ga0103748_10042099 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 760 | Open in IMG/M |
3300009203|Ga0103749_10021317 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 842 | Open in IMG/M |
3300009203|Ga0103749_10025200 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 784 | Open in IMG/M |
3300009206|Ga0103750_1022279 | Not Available | 725 | Open in IMG/M |
3300009281|Ga0103744_10183314 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 505 | Open in IMG/M |
3300009295|Ga0103747_10030266 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
3300009295|Ga0103747_10106864 | Not Available | 720 | Open in IMG/M |
3300009348|Ga0103786_1002964 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300009348|Ga0103786_1002965 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300009349|Ga0103787_1007408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis aeruginosa → Microcystis aeruginosa PCC 7806 | 757 | Open in IMG/M |
3300009525|Ga0116220_10094633 | Not Available | 1263 | Open in IMG/M |
3300009551|Ga0105238_11769875 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 650 | Open in IMG/M |
3300009553|Ga0105249_12541979 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 584 | Open in IMG/M |
3300009597|Ga0105259_1044052 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 984 | Open in IMG/M |
3300009628|Ga0116125_1129500 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 689 | Open in IMG/M |
3300009644|Ga0116121_1106434 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 880 | Open in IMG/M |
3300009650|Ga0105857_1286260 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 503 | Open in IMG/M |
3300009672|Ga0116215_1039048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2174 | Open in IMG/M |
3300009683|Ga0116224_10543471 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 554 | Open in IMG/M |
3300009691|Ga0114944_1244300 | Not Available | 727 | Open in IMG/M |
3300009735|Ga0123377_1011285 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 609 | Open in IMG/M |
3300009870|Ga0131092_10233767 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1870 | Open in IMG/M |
3300010061|Ga0127462_167549 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300010063|Ga0127431_123394 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300010064|Ga0127433_103551 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300010065|Ga0127435_154191 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 579 | Open in IMG/M |
3300010069|Ga0127467_105623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 832 | Open in IMG/M |
3300010069|Ga0127467_127282 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 687 | Open in IMG/M |
3300010072|Ga0127428_104256 | Not Available | 605 | Open in IMG/M |
3300010072|Ga0127428_105392 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300010074|Ga0127439_131594 | Not Available | 1080 | Open in IMG/M |
3300010074|Ga0127439_137785 | Not Available | 519 | Open in IMG/M |
3300010075|Ga0127434_107165 | Not Available | 819 | Open in IMG/M |
3300010075|Ga0127434_127246 | Not Available | 575 | Open in IMG/M |
3300010075|Ga0127434_142987 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300010078|Ga0127487_138364 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 508 | Open in IMG/M |
3300010082|Ga0127469_139641 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 685 | Open in IMG/M |
3300010082|Ga0127469_156058 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 612 | Open in IMG/M |
3300010083|Ga0127478_1096970 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 579 | Open in IMG/M |
3300010086|Ga0127496_1035978 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300010086|Ga0127496_1088224 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 868 | Open in IMG/M |
3300010088|Ga0127476_1024366 | Not Available | 531 | Open in IMG/M |
3300010091|Ga0127485_1082356 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 953 | Open in IMG/M |
3300010092|Ga0127468_1034014 | Not Available | 1542 | Open in IMG/M |
3300010092|Ga0127468_1092847 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 937 | Open in IMG/M |
3300010093|Ga0127490_1011657 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 503 | Open in IMG/M |
3300010094|Ga0127480_1045295 | Not Available | 682 | Open in IMG/M |
3300010096|Ga0127473_1018310 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 545 | Open in IMG/M |
3300010096|Ga0127473_1056391 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 810 | Open in IMG/M |
3300010096|Ga0127473_1096773 | Not Available | 611 | Open in IMG/M |
3300010098|Ga0127463_1096185 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 570 | Open in IMG/M |
3300010099|Ga0127450_1047678 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana | 660 | Open in IMG/M |
3300010100|Ga0127440_1090159 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300010102|Ga0127453_1063132 | Not Available | 786 | Open in IMG/M |
3300010102|Ga0127453_1067400 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300010104|Ga0127446_1023401 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 845 | Open in IMG/M |
3300010105|Ga0127470_1052723 | Not Available | 521 | Open in IMG/M |
3300010107|Ga0127494_1025049 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300010114|Ga0127460_1071534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 543 | Open in IMG/M |
3300010116|Ga0127466_1117368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 895 | Open in IMG/M |
3300010118|Ga0127465_1094332 | Not Available | 750 | Open in IMG/M |
3300010120|Ga0127451_1075695 | Not Available | 642 | Open in IMG/M |
3300010121|Ga0127438_1167832 | Not Available | 742 | Open in IMG/M |
3300010123|Ga0127479_1044846 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300010123|Ga0127479_1170372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
3300010128|Ga0127486_1169601 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 670 | Open in IMG/M |
3300010133|Ga0127459_1043580 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300010138|Ga0115595_1066387 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300010139|Ga0127464_1199140 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 516 | Open in IMG/M |
3300010141|Ga0127499_1109273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 615 | Open in IMG/M |
3300010143|Ga0126322_1048539 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 571 | Open in IMG/M |
3300010145|Ga0126321_1304690 | Not Available | 745 | Open in IMG/M |
3300010343|Ga0074044_10654376 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300010349|Ga0116240_10625653 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300010358|Ga0126370_11925153 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 576 | Open in IMG/M |
3300010359|Ga0126376_12158766 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 601 | Open in IMG/M |
3300010375|Ga0105239_10966852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 978 | Open in IMG/M |
3300010379|Ga0136449_104113644 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 541 | Open in IMG/M |
3300010391|Ga0136847_10638593 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 705 | Open in IMG/M |
3300010398|Ga0126383_11257636 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 830 | Open in IMG/M |
3300010401|Ga0134121_10085398 | Not Available | 2630 | Open in IMG/M |
3300010857|Ga0126354_1073897 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 775 | Open in IMG/M |
3300010857|Ga0126354_1154118 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 590 | Open in IMG/M |
3300010859|Ga0126352_1064175 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 715 | Open in IMG/M |
3300010860|Ga0126351_1058635 | Not Available | 910 | Open in IMG/M |
3300010861|Ga0126349_1269103 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300010861|Ga0126349_1306523 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 602 | Open in IMG/M |
3300010869|Ga0126359_1122211 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 704 | Open in IMG/M |
3300010872|Ga0136897_10836783 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1083 | Open in IMG/M |
3300010896|Ga0138111_1097455 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana | 684 | Open in IMG/M |
3300011031|Ga0138543_132078 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 505 | Open in IMG/M |
3300011035|Ga0138542_140860 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 573 | Open in IMG/M |
3300011041|Ga0138591_102318 | Not Available | 705 | Open in IMG/M |
3300011049|Ga0138554_175603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 618 | Open in IMG/M |
3300011051|Ga0138540_113619 | Not Available | 594 | Open in IMG/M |
3300011057|Ga0138544_1093441 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 820 | Open in IMG/M |
3300011059|Ga0138597_1035589 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 551 | Open in IMG/M |
3300011067|Ga0138594_1005133 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 500 | Open in IMG/M |
3300011071|Ga0138595_1016529 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300011073|Ga0138584_1041284 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 570 | Open in IMG/M |
3300011075|Ga0138555_1085549 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 974 | Open in IMG/M |
3300011078|Ga0138565_1124412 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 880 | Open in IMG/M |
3300011080|Ga0138568_1025338 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 694 | Open in IMG/M |
3300011080|Ga0138568_1202853 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 518 | Open in IMG/M |
3300011081|Ga0138575_1038906 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 593 | Open in IMG/M |
3300011084|Ga0138562_1208656 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 671 | Open in IMG/M |
3300011090|Ga0138579_1117913 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300011120|Ga0150983_12090997 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 542 | Open in IMG/M |
3300011120|Ga0150983_16341290 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 603 | Open in IMG/M |
3300011271|Ga0137393_10285877 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 1403 | Open in IMG/M |
3300011300|Ga0138364_1115216 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300011316|Ga0138399_1022635 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 927 | Open in IMG/M |
3300011327|Ga0138398_1128297 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 675 | Open in IMG/M |
3300011340|Ga0151652_12757345 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
3300011404|Ga0153951_1043170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldalkalibacillus → Caldalkalibacillus thermarum → Caldalkalibacillus thermarum TA2.A1 | 785 | Open in IMG/M |
3300012177|Ga0153943_1069076 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 743 | Open in IMG/M |
3300012180|Ga0153974_1102914 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 649 | Open in IMG/M |
3300012181|Ga0153922_1111032 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 628 | Open in IMG/M |
3300012205|Ga0137362_10861935 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300012211|Ga0137377_10706357 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 943 | Open in IMG/M |
3300012212|Ga0150985_100832320 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1031 | Open in IMG/M |
3300012212|Ga0150985_101449137 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 767 | Open in IMG/M |
3300012212|Ga0150985_105925484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
3300012212|Ga0150985_110492208 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300012212|Ga0150985_111164913 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1341 | Open in IMG/M |
3300012224|Ga0134028_1246109 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300012355|Ga0137369_10377076 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 1029 | Open in IMG/M |
3300012361|Ga0137360_11335517 | Not Available | 619 | Open in IMG/M |
3300012363|Ga0137390_11125894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 734 | Open in IMG/M |
3300012364|Ga0134027_1070952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 611 | Open in IMG/M |
3300012376|Ga0134032_1082832 | Not Available | 614 | Open in IMG/M |
3300012385|Ga0134023_1249935 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 545 | Open in IMG/M |
3300012386|Ga0134046_1055460 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300012389|Ga0134040_1202060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter towneri → Acinetobacter towneri DSM 14962 = CIP 107472 | 567 | Open in IMG/M |
3300012390|Ga0134054_1278843 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 557 | Open in IMG/M |
3300012404|Ga0134024_1373333 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Thermotoga → unclassified Thermotoga → Thermotoga sp. TBYP3.1.4.1 | 709 | Open in IMG/M |
3300012405|Ga0134041_1241093 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 683 | Open in IMG/M |
3300012407|Ga0134050_1296255 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 501 | Open in IMG/M |
3300012469|Ga0150984_105206171 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 551 | Open in IMG/M |
3300012469|Ga0150984_105213739 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 1163 | Open in IMG/M |
3300012469|Ga0150984_106269700 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 640 | Open in IMG/M |
3300012469|Ga0150984_109107083 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 535 | Open in IMG/M |
3300012469|Ga0150984_120093440 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 553 | Open in IMG/M |
3300012469|Ga0150984_120293926 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300012683|Ga0137398_11083146 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300012693|Ga0157573_1042948 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 551 | Open in IMG/M |
3300012737|Ga0157525_118557 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300012768|Ga0138276_1001844 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300012770|Ga0138291_1044509 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300012775|Ga0138280_1215013 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 639 | Open in IMG/M |
3300012776|Ga0138275_1056934 | Not Available | 848 | Open in IMG/M |
3300012907|Ga0157283_10145058 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 693 | Open in IMG/M |
3300012975|Ga0134110_10527441 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 540 | Open in IMG/M |
(restricted) 3300013127|Ga0172365_10167384 | Not Available | 1362 | Open in IMG/M |
3300013295|Ga0170791_12374390 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 523 | Open in IMG/M |
3300013766|Ga0120181_1150167 | Not Available | 505 | Open in IMG/M |
3300014157|Ga0134078_10508020 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 561 | Open in IMG/M |
3300014164|Ga0181532_10142124 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1452 | Open in IMG/M |
3300014165|Ga0181523_10055143 | All Organisms → cellular organisms → Bacteria | 2454 | Open in IMG/M |
3300014201|Ga0181537_10170690 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1494 | Open in IMG/M |
3300014298|Ga0075341_1106131 | Not Available | 554 | Open in IMG/M |
3300014655|Ga0181516_10577798 | Not Available | 579 | Open in IMG/M |
3300014838|Ga0182030_10385994 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
3300014879|Ga0180062_1098277 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 665 | Open in IMG/M |
3300015201|Ga0173478_10444106 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300015245|Ga0137409_10544719 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 987 | Open in IMG/M |
3300015360|Ga0163144_10595569 | Not Available | 1199 | Open in IMG/M |
3300015372|Ga0132256_103002809 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 567 | Open in IMG/M |
3300016341|Ga0182035_10718435 | Not Available | 872 | Open in IMG/M |
3300016683|Ga0180042_154712 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300016700|Ga0181513_1181727 | Not Available | 683 | Open in IMG/M |
3300016705|Ga0181507_1036149 | Not Available | 687 | Open in IMG/M |
3300016750|Ga0181505_10270608 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300016750|Ga0181505_10357712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 557 | Open in IMG/M |
3300016750|Ga0181505_10667323 | Not Available | 565 | Open in IMG/M |
3300016750|Ga0181505_10902160 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 563 | Open in IMG/M |
3300017947|Ga0187785_10610461 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 561 | Open in IMG/M |
3300017975|Ga0187782_10396526 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1048 | Open in IMG/M |
3300017994|Ga0187822_10323317 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 550 | Open in IMG/M |
3300018032|Ga0187788_10369429 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 596 | Open in IMG/M |
3300018043|Ga0187887_10044184 | Not Available | 2756 | Open in IMG/M |
3300018058|Ga0187766_10906760 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300018060|Ga0187765_10499331 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 769 | Open in IMG/M |
3300018060|Ga0187765_11182025 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 535 | Open in IMG/M |
3300018090|Ga0187770_10387568 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1097 | Open in IMG/M |
3300019207|Ga0180034_1085891 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300019208|Ga0180110_1148765 | All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1 | 666 | Open in IMG/M |
3300019228|Ga0180119_1239937 | Not Available | 827 | Open in IMG/M |
3300019238|Ga0180112_1357948 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
3300019240|Ga0181510_1334341 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 582 | Open in IMG/M |
3300019256|Ga0181508_1082861 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 768 | Open in IMG/M |
3300019258|Ga0181504_1111217 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300019258|Ga0181504_1439546 | Not Available | 1491 | Open in IMG/M |
3300019259|Ga0184646_1257897 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 608 | Open in IMG/M |
3300019263|Ga0184647_1397902 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 928 | Open in IMG/M |
3300019264|Ga0187796_1385114 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 823 | Open in IMG/M |
3300019265|Ga0187792_1703423 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 598 | Open in IMG/M |
3300019268|Ga0181514_1021359 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300019273|Ga0187794_1063742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 758 | Open in IMG/M |
3300020063|Ga0180118_1289203 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 745 | Open in IMG/M |
3300020068|Ga0184649_1135580 | Not Available | 506 | Open in IMG/M |
3300020076|Ga0206355_1430392 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 612 | Open in IMG/M |
3300020080|Ga0206350_10781044 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300020082|Ga0206353_11970453 | Not Available | 514 | Open in IMG/M |
3300020157|Ga0194049_1007620 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2868 | Open in IMG/M |
3300020192|Ga0163147_10035741 | Not Available | 4055 | Open in IMG/M |
3300020195|Ga0163150_10376427 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 663 | Open in IMG/M |
3300020200|Ga0194121_10023127 | Not Available | 6196 | Open in IMG/M |
3300021151|Ga0179584_1089650 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 543 | Open in IMG/M |
3300021170|Ga0210400_11158194 | Not Available | 624 | Open in IMG/M |
3300021258|Ga0210345_145379 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 599 | Open in IMG/M |
3300021266|Ga0210348_114120 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 767 | Open in IMG/M |
3300021266|Ga0210348_123734 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 628 | Open in IMG/M |
3300021269|Ga0210356_143823 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 554 | Open in IMG/M |
3300021277|Ga0210352_131892 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300021299|Ga0210302_1116007 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300021304|Ga0210331_1050698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter towneri → Acinetobacter towneri DSM 14962 = CIP 107472 | 606 | Open in IMG/M |
3300021313|Ga0210333_1342878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 701 | Open in IMG/M |
3300021314|Ga0210370_1171404 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 673 | Open in IMG/M |
3300021362|Ga0213882_10090233 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300021388|Ga0213875_10285989 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Thermotoga → unclassified Thermotoga → Thermotoga sp. TBYP3.1.4.1 | 779 | Open in IMG/M |
3300021406|Ga0210386_10099173 | Not Available | 2386 | Open in IMG/M |
3300021560|Ga0126371_11561626 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 787 | Open in IMG/M |
3300021844|Ga0210361_141684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 816 | Open in IMG/M |
3300021844|Ga0210361_170530 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 992 | Open in IMG/M |
3300021852|Ga0210317_1138093 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300021860|Ga0213851_1252722 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 535 | Open in IMG/M |
3300021860|Ga0213851_1378393 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 783 | Open in IMG/M |
3300021947|Ga0213856_1263329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 952 | Open in IMG/M |
3300021947|Ga0213856_1288405 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 632 | Open in IMG/M |
3300022166|Ga0213932_1063819 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 545 | Open in IMG/M |
3300022498|Ga0242644_1007121 | Not Available | 933 | Open in IMG/M |
3300022498|Ga0242644_1012451 | Not Available | 781 | Open in IMG/M |
3300022498|Ga0242644_1012566 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 778 | Open in IMG/M |
3300022498|Ga0242644_1037565 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300022499|Ga0242641_1010720 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300022499|Ga0242641_1010841 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 812 | Open in IMG/M |
3300022499|Ga0242641_1012801 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 774 | Open in IMG/M |
3300022499|Ga0242641_1030505 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300022499|Ga0242641_1046651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 515 | Open in IMG/M |
3300022500|Ga0242643_101435 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
3300022500|Ga0242643_105575 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 819 | Open in IMG/M |
3300022500|Ga0242643_113620 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 613 | Open in IMG/M |
3300022501|Ga0242645_1006233 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300022501|Ga0242645_1023244 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300022501|Ga0242645_1030644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5 | 511 | Open in IMG/M |
3300022502|Ga0242646_1029549 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 557 | Open in IMG/M |
3300022503|Ga0242650_1007353 | Not Available | 766 | Open in IMG/M |
3300022503|Ga0242650_1014705 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300022504|Ga0242642_1001500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2222 | Open in IMG/M |
3300022504|Ga0242642_1003554 | Not Available | 1663 | Open in IMG/M |
3300022504|Ga0242642_1008403 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1230 | Open in IMG/M |
3300022504|Ga0242642_1009375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1182 | Open in IMG/M |
3300022504|Ga0242642_1010480 | Not Available | 1134 | Open in IMG/M |
3300022504|Ga0242642_1010497 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300022504|Ga0242642_1019224 | Not Available | 918 | Open in IMG/M |
3300022504|Ga0242642_1027987 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 802 | Open in IMG/M |
3300022504|Ga0242642_1041766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300022504|Ga0242642_1053825 | Not Available | 632 | Open in IMG/M |
3300022504|Ga0242642_1057170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 619 | Open in IMG/M |
3300022504|Ga0242642_1076252 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300022504|Ga0242642_1080279 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 548 | Open in IMG/M |
3300022504|Ga0242642_1099798 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 507 | Open in IMG/M |
3300022504|Ga0242642_1103039 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300022505|Ga0242647_1001559 | All Organisms → cellular organisms → Eukaryota | 1530 | Open in IMG/M |
3300022505|Ga0242647_1008786 | Not Available | 871 | Open in IMG/M |
3300022505|Ga0242647_1022034 | Not Available | 645 | Open in IMG/M |
3300022506|Ga0242648_1007762 | Not Available | 1143 | Open in IMG/M |
3300022506|Ga0242648_1037110 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 700 | Open in IMG/M |
3300022506|Ga0242648_1045376 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300022507|Ga0222729_1001645 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300022507|Ga0222729_1005706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1173 | Open in IMG/M |
3300022507|Ga0222729_1007192 | Not Available | 1087 | Open in IMG/M |
3300022507|Ga0222729_1036886 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 639 | Open in IMG/M |
3300022507|Ga0222729_1053898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 562 | Open in IMG/M |
3300022507|Ga0222729_1055802 | Not Available | 556 | Open in IMG/M |
3300022508|Ga0222728_1027806 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 858 | Open in IMG/M |
3300022508|Ga0222728_1031698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
3300022508|Ga0222728_1046279 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300022508|Ga0222728_1057450 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 667 | Open in IMG/M |
3300022508|Ga0222728_1084951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
3300022509|Ga0242649_1006574 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300022509|Ga0242649_1006869 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1123 | Open in IMG/M |
3300022509|Ga0242649_1010992 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 964 | Open in IMG/M |
3300022509|Ga0242649_1027945 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300022509|Ga0242649_1033045 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300022509|Ga0242649_1054534 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 570 | Open in IMG/M |
3300022509|Ga0242649_1056181 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300022509|Ga0242649_1072410 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 519 | Open in IMG/M |
3300022509|Ga0242649_1072953 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300022510|Ga0242652_1033066 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 602 | Open in IMG/M |
3300022511|Ga0242651_1020120 | Not Available | 694 | Open in IMG/M |
3300022511|Ga0242651_1022271 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 671 | Open in IMG/M |
3300022511|Ga0242651_1047929 | Not Available | 522 | Open in IMG/M |
3300022513|Ga0242667_1039547 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 568 | Open in IMG/M |
3300022522|Ga0242659_1027032 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 919 | Open in IMG/M |
3300022522|Ga0242659_1027857 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 908 | Open in IMG/M |
3300022522|Ga0242659_1039505 | Not Available | 802 | Open in IMG/M |
3300022522|Ga0242659_1075719 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 634 | Open in IMG/M |
3300022523|Ga0242663_1003267 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
3300022523|Ga0242663_1063193 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 677 | Open in IMG/M |
3300022523|Ga0242663_1077996 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300022523|Ga0242663_1087354 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 605 | Open in IMG/M |
3300022527|Ga0242664_1082073 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 638 | Open in IMG/M |
3300022528|Ga0242669_1111988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 540 | Open in IMG/M |
3300022529|Ga0242668_1097600 | Not Available | 592 | Open in IMG/M |
3300022530|Ga0242658_1021227 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 1174 | Open in IMG/M |
3300022530|Ga0242658_1136657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 621 | Open in IMG/M |
3300022530|Ga0242658_1149802 | Not Available | 601 | Open in IMG/M |
3300022530|Ga0242658_1178148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 565 | Open in IMG/M |
3300022531|Ga0242660_1048258 | Not Available | 920 | Open in IMG/M |
3300022531|Ga0242660_1060109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 852 | Open in IMG/M |
3300022531|Ga0242660_1105043 | Not Available | 695 | Open in IMG/M |
3300022531|Ga0242660_1211964 | Not Available | 537 | Open in IMG/M |
3300022532|Ga0242655_10057460 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300022532|Ga0242655_10189502 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 624 | Open in IMG/M |
3300022532|Ga0242655_10229536 | Not Available | 579 | Open in IMG/M |
3300022533|Ga0242662_10213192 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 613 | Open in IMG/M |
3300022708|Ga0242670_1014916 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300022708|Ga0242670_1018095 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 817 | Open in IMG/M |
3300022708|Ga0242670_1029265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 703 | Open in IMG/M |
3300022711|Ga0242674_1051960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 566 | Open in IMG/M |
3300022712|Ga0242653_1012584 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300022713|Ga0242677_1010498 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1006 | Open in IMG/M |
3300022713|Ga0242677_1062545 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae | 570 | Open in IMG/M |
3300022716|Ga0242673_1030913 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 821 | Open in IMG/M |
3300022716|Ga0242673_1031175 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300022716|Ga0242673_1061259 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300022717|Ga0242661_1008797 | Not Available | 1407 | Open in IMG/M |
3300022717|Ga0242661_1027066 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300022717|Ga0242661_1027129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 965 | Open in IMG/M |
3300022717|Ga0242661_1034981 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300022717|Ga0242661_1055095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
3300022717|Ga0242661_1059312 | Not Available | 732 | Open in IMG/M |
3300022717|Ga0242661_1085269 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300022717|Ga0242661_1152494 | Not Available | 519 | Open in IMG/M |
3300022717|Ga0242661_1157426 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 513 | Open in IMG/M |
3300022718|Ga0242675_1004307 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1484 | Open in IMG/M |
3300022718|Ga0242675_1020447 | Not Available | 924 | Open in IMG/M |
3300022720|Ga0242672_1025079 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 861 | Open in IMG/M |
3300022720|Ga0242672_1037482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 765 | Open in IMG/M |
3300022722|Ga0242657_1154329 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 607 | Open in IMG/M |
3300022722|Ga0242657_1228304 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 525 | Open in IMG/M |
3300022724|Ga0242665_10066003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
3300022724|Ga0242665_10357588 | Not Available | 524 | Open in IMG/M |
3300022726|Ga0242654_10152300 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 773 | Open in IMG/M |
3300022726|Ga0242654_10260334 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 625 | Open in IMG/M |
3300022726|Ga0242654_10268856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300022726|Ga0242654_10272962 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300022726|Ga0242654_10275595 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300022726|Ga0242654_10290467 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
(restricted) 3300023208|Ga0233424_10004166 | All Organisms → cellular organisms → Bacteria | 8941 | Open in IMG/M |
3300023544|Ga0247542_102613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 670 | Open in IMG/M |
3300023656|Ga0247547_102196 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 611 | Open in IMG/M |
3300023706|Ga0232123_1053410 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 805 | Open in IMG/M |
3300024532|Ga0256352_1043156 | Not Available | 808 | Open in IMG/M |
3300025310|Ga0209172_10116852 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1505 | Open in IMG/M |
3300025314|Ga0209323_10713139 | Not Available | 544 | Open in IMG/M |
3300025848|Ga0208005_1172661 | Not Available | 673 | Open in IMG/M |
3300025924|Ga0207694_10001965 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 17007 | Open in IMG/M |
3300025972|Ga0207668_11399131 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300026221|Ga0209848_1018319 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1371 | Open in IMG/M |
3300026542|Ga0209805_1152207 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1061 | Open in IMG/M |
3300026542|Ga0209805_1183150 | Not Available | 924 | Open in IMG/M |
3300026557|Ga0179587_10813407 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300026565|Ga0256311_1028430 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
3300027039|Ga0207855_1032269 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 708 | Open in IMG/M |
3300027568|Ga0208042_1008964 | Not Available | 2685 | Open in IMG/M |
3300027680|Ga0207826_1225837 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 501 | Open in IMG/M |
3300027681|Ga0208991_1045149 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1331 | Open in IMG/M |
3300027848|Ga0209390_10010185 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 11070 | Open in IMG/M |
3300027850|Ga0209591_10433365 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 895 | Open in IMG/M |
3300027986|Ga0209168_10601909 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 526 | Open in IMG/M |
3300028077|Ga0256323_1026158 | Not Available | 865 | Open in IMG/M |
3300028108|Ga0256305_1011313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2199 | Open in IMG/M |
3300028592|Ga0247822_10284675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1259 | Open in IMG/M |
3300028668|Ga0257140_1028917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldalkalibacillus → Caldalkalibacillus thermarum → Caldalkalibacillus thermarum TA2.A1 | 1046 | Open in IMG/M |
(restricted) 3300029268|Ga0247842_10122700 | Not Available | 1549 | Open in IMG/M |
3300029659|Ga0206094_110017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 768 | Open in IMG/M |
3300030006|Ga0299907_10983787 | Not Available | 621 | Open in IMG/M |
3300030058|Ga0302179_10325704 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 677 | Open in IMG/M |
3300030525|Ga0210273_1150696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfonauticaceae → Desulfonauticus → unclassified Desulfonauticus → Desulfonauticus sp. 38_4375 | 522 | Open in IMG/M |
3300030528|Ga0210277_10377277 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 713 | Open in IMG/M |
3300030528|Ga0210277_10525017 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300030532|Ga0210290_1200601 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 663 | Open in IMG/M |
3300030537|Ga0247642_1024526 | Not Available | 608 | Open in IMG/M |
3300030540|Ga0247649_1050379 | Not Available | 597 | Open in IMG/M |
3300030540|Ga0247649_1093913 | Not Available | 526 | Open in IMG/M |
3300030543|Ga0210289_1320294 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 603 | Open in IMG/M |
3300030545|Ga0210271_10886848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5 | 1106 | Open in IMG/M |
3300030554|Ga0247640_1107789 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea | 652 | Open in IMG/M |
3300030564|Ga0210256_10326686 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 650 | Open in IMG/M |
3300030569|Ga0247628_1124306 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 686 | Open in IMG/M |
3300030570|Ga0247647_1169604 | Not Available | 603 | Open in IMG/M |
3300030584|Ga0247658_1142416 | Not Available | 520 | Open in IMG/M |
3300030589|Ga0210255_10183659 | Not Available | 1327 | Open in IMG/M |
3300030596|Ga0210278_1048350 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300030598|Ga0210287_1090654 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 719 | Open in IMG/M |
3300030600|Ga0247659_1226950 | Not Available | 507 | Open in IMG/M |
3300030602|Ga0210254_10490860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Anoxybacillus → unclassified Anoxybacillus → Anoxybacillus sp. BCO1 | 1246 | Open in IMG/M |
3300030604|Ga0247637_1200433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldalkalibacillus → Caldalkalibacillus thermarum → Caldalkalibacillus thermarum TA2.A1 | 521 | Open in IMG/M |
3300030605|Ga0210265_1130650 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 556 | Open in IMG/M |
3300030607|Ga0247615_10374166 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300030624|Ga0210251_11080031 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 502 | Open in IMG/M |
3300030629|Ga0210268_1221766 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 614 | Open in IMG/M |
3300030633|Ga0247623_10028535 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300030633|Ga0247623_10325633 | Not Available | 514 | Open in IMG/M |
3300030635|Ga0247627_10184637 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 629 | Open in IMG/M |
3300030684|Ga0247617_1149919 | Not Available | 504 | Open in IMG/M |
3300030740|Ga0265460_10960297 | Not Available | 781 | Open in IMG/M |
3300030740|Ga0265460_12966437 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 510 | Open in IMG/M |
3300030741|Ga0265459_10979506 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 883 | Open in IMG/M |
3300030741|Ga0265459_13255951 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 568 | Open in IMG/M |
3300030751|Ga0102764_1942093 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300030758|Ga0138305_1559167 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Tricladiaceae → Cudoniella → Cudoniella acicularis | 1176 | Open in IMG/M |
3300030760|Ga0265762_1068170 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 742 | Open in IMG/M |
3300030763|Ga0265763_1031767 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300030774|Ga0074007_10152543 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300030777|Ga0075402_10137217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1129 | Open in IMG/M |
3300030777|Ga0075402_12319934 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 517 | Open in IMG/M |
3300030777|Ga0075402_12478280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 578 | Open in IMG/M |
3300030778|Ga0075398_10053193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 677 | Open in IMG/M |
3300030778|Ga0075398_12218360 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 687 | Open in IMG/M |
3300030782|Ga0102754_1059889 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1035 | Open in IMG/M |
3300030783|Ga0102752_1030336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 667 | Open in IMG/M |
3300030784|Ga0102758_10088004 | Not Available | 777 | Open in IMG/M |
3300030790|Ga0138304_1026964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldalkalibacillus → Caldalkalibacillus thermarum → Caldalkalibacillus thermarum TA2.A1 | 1128 | Open in IMG/M |
3300030829|Ga0308203_1035762 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300030830|Ga0308205_1021096 | Not Available | 748 | Open in IMG/M |
3300030831|Ga0308152_112072 | Not Available | 553 | Open in IMG/M |
3300030839|Ga0073999_10135108 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 800 | Open in IMG/M |
3300030843|Ga0075392_10065822 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 666 | Open in IMG/M |
3300030845|Ga0075397_10054530 | Not Available | 695 | Open in IMG/M |
3300030848|Ga0075388_10092474 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 954 | Open in IMG/M |
3300030849|Ga0075393_10085399 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1084 | Open in IMG/M |
3300030852|Ga0075389_10068142 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium P201 | 973 | Open in IMG/M |
3300030854|Ga0075385_10049413 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 540 | Open in IMG/M |
3300030855|Ga0075374_10077066 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 666 | Open in IMG/M |
3300030855|Ga0075374_10091104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfonauticaceae → Desulfonauticus → unclassified Desulfonauticus → Desulfonauticus sp. 38_4375 | 686 | Open in IMG/M |
3300030855|Ga0075374_10129124 | Not Available | 749 | Open in IMG/M |
3300030858|Ga0102759_1027780 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 574 | Open in IMG/M |
3300030858|Ga0102759_1973515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5 | 539 | Open in IMG/M |
3300030858|Ga0102759_1976026 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 876 | Open in IMG/M |
3300030867|Ga0102749_1002102 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana | 793 | Open in IMG/M |
3300030867|Ga0102749_1009694 | Not Available | 1099 | Open in IMG/M |
3300030867|Ga0102749_1027453 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 533 | Open in IMG/M |
3300030880|Ga0265776_107977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5 | 594 | Open in IMG/M |
3300030880|Ga0265776_110210 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 554 | Open in IMG/M |
3300030886|Ga0265772_101753 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 810 | Open in IMG/M |
3300030904|Ga0308198_1099469 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 509 | Open in IMG/M |
3300030917|Ga0075382_10041826 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 643 | Open in IMG/M |
3300030917|Ga0075382_10052342 | Not Available | 748 | Open in IMG/M |
3300030917|Ga0075382_10106568 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 847 | Open in IMG/M |
3300030917|Ga0075382_10120044 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 642 | Open in IMG/M |
3300030920|Ga0102762_1045026 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 692 | Open in IMG/M |
3300030923|Ga0138296_1792429 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300030936|Ga0138306_1442349 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300030936|Ga0138306_1597972 | Not Available | 850 | Open in IMG/M |
3300030939|Ga0138303_1111600 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 553 | Open in IMG/M |
3300030939|Ga0138303_1280555 | Not Available | 958 | Open in IMG/M |
3300030939|Ga0138303_1409319 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300030939|Ga0138303_1467501 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 920 | Open in IMG/M |
3300030939|Ga0138303_1479343 | Not Available | 809 | Open in IMG/M |
3300030942|Ga0247549_100385 | Not Available | 1219 | Open in IMG/M |
3300030945|Ga0075373_11662534 | Not Available | 700 | Open in IMG/M |
3300030947|Ga0075390_10022289 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 707 | Open in IMG/M |
3300030950|Ga0074034_10052725 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 969 | Open in IMG/M |
3300030950|Ga0074034_10053662 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 729 | Open in IMG/M |
3300030960|Ga0102745_1029909 | Not Available | 680 | Open in IMG/M |
3300030960|Ga0102745_1045491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Oribacterium → unclassified Oribacterium → Oribacterium sp. oral taxon 078 → Oribacterium sp. oral taxon 078 str. F0262 | 992 | Open in IMG/M |
3300030960|Ga0102745_1800529 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300030963|Ga0265768_101787 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1046 | Open in IMG/M |
3300030969|Ga0075394_10152832 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300030970|Ga0075381_10104898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5 | 791 | Open in IMG/M |
3300030970|Ga0075381_10121038 | Not Available | 755 | Open in IMG/M |
3300030970|Ga0075381_10156744 | Not Available | 944 | Open in IMG/M |
3300030973|Ga0075395_10028516 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 762 | Open in IMG/M |
3300030973|Ga0075395_10047572 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300030974|Ga0075371_10023734 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 501 | Open in IMG/M |
3300030975|Ga0099845_1045685 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 547 | Open in IMG/M |
3300030981|Ga0102770_10027533 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300030981|Ga0102770_10028148 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 779 | Open in IMG/M |
3300030982|Ga0265748_100740 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana | 1080 | Open in IMG/M |
3300030986|Ga0308154_105898 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300030990|Ga0308178_1033635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 888 | Open in IMG/M |
3300030997|Ga0073997_10106298 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300031011|Ga0265774_103575 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300031013|Ga0102753_1019658 | Not Available | 1864 | Open in IMG/M |
3300031015|Ga0138298_1373153 | Not Available | 851 | Open in IMG/M |
3300031015|Ga0138298_1734506 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300031016|Ga0265732_103868 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300031018|Ga0265773_1010045 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 792 | Open in IMG/M |
3300031021|Ga0102765_10141037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1032 | Open in IMG/M |
3300031022|Ga0138301_1130523 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 539 | Open in IMG/M |
3300031022|Ga0138301_1169884 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 759 | Open in IMG/M |
3300031022|Ga0138301_1646917 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 541 | Open in IMG/M |
3300031023|Ga0073998_10086681 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 1183 | Open in IMG/M |
3300031039|Ga0102760_10007067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
3300031041|Ga0265755_108154 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 634 | Open in IMG/M |
3300031042|Ga0265749_104086 | Not Available | 545 | Open in IMG/M |
3300031047|Ga0073995_10058613 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 805 | Open in IMG/M |
3300031047|Ga0073995_10079865 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300031053|Ga0074018_1788077 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 546 | Open in IMG/M |
3300031054|Ga0102746_10036210 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300031054|Ga0102746_10038288 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1296 | Open in IMG/M |
3300031054|Ga0102746_10069672 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 561 | Open in IMG/M |
3300031054|Ga0102746_10072779 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1320 | Open in IMG/M |
3300031054|Ga0102746_10088632 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 716 | Open in IMG/M |
3300031055|Ga0102751_1395022 | Not Available | 565 | Open in IMG/M |
3300031057|Ga0170834_103779642 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 510 | Open in IMG/M |
3300031057|Ga0170834_108260792 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 699 | Open in IMG/M |
3300031082|Ga0308192_1032658 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana | 727 | Open in IMG/M |
3300031089|Ga0102748_10063411 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300031089|Ga0102748_10103775 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 527 | Open in IMG/M |
3300031091|Ga0308201_10259425 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 602 | Open in IMG/M |
3300031094|Ga0308199_1109153 | Not Available | 618 | Open in IMG/M |
3300031096|Ga0308193_1063088 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300031097|Ga0308188_1026893 | Not Available | 578 | Open in IMG/M |
3300031114|Ga0308187_10163920 | Not Available | 752 | Open in IMG/M |
3300031122|Ga0170822_10389666 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Russulales → Auriscalpiaceae → Artomyces → Artomyces pyxidatus | 1075 | Open in IMG/M |
3300031122|Ga0170822_13428200 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 741 | Open in IMG/M |
3300031123|Ga0308195_1046149 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300031124|Ga0308151_1025355 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 633 | Open in IMG/M |
3300031125|Ga0308182_1007395 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 799 | Open in IMG/M |
3300031231|Ga0170824_100872420 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 535 | Open in IMG/M |
3300031231|Ga0170824_101707205 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 625 | Open in IMG/M |
3300031231|Ga0170824_102753273 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 580 | Open in IMG/M |
3300031231|Ga0170824_114876895 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 788 | Open in IMG/M |
3300031231|Ga0170824_125717903 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300031424|Ga0308179_1003431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 1264 | Open in IMG/M |
3300031424|Ga0308179_1015726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 789 | Open in IMG/M |
3300031446|Ga0170820_13114062 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 725 | Open in IMG/M |
3300031446|Ga0170820_13332626 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300031446|Ga0170820_14995991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 555 | Open in IMG/M |
3300031446|Ga0170820_16500096 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 568 | Open in IMG/M |
3300031446|Ga0170820_16600355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → Geobacillus thermoleovorans group → Geobacillus thermoleovorans → Geobacillus thermoleovorans CCB_US3_UF5 | 713 | Open in IMG/M |
3300031469|Ga0170819_10318632 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 530 | Open in IMG/M |
3300031469|Ga0170819_16154974 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 689 | Open in IMG/M |
3300031469|Ga0170819_17573572 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300031469|Ga0170819_17984762 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 552 | Open in IMG/M |
3300031474|Ga0170818_103481289 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300031474|Ga0170818_103588779 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 528 | Open in IMG/M |
3300031474|Ga0170818_105692137 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 579 | Open in IMG/M |
3300031474|Ga0170818_106290922 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 572 | Open in IMG/M |
3300031474|Ga0170818_106583517 | Not Available | 855 | Open in IMG/M |
3300031484|Ga0314822_110869 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 558 | Open in IMG/M |
3300031499|Ga0314818_111414 | Not Available | 542 | Open in IMG/M |
3300031573|Ga0310915_10378025 | Not Available | 1005 | Open in IMG/M |
3300031573|Ga0310915_10706435 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 712 | Open in IMG/M |
3300031890|Ga0306925_10788359 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 987 | Open in IMG/M |
3300031891|Ga0316039_117513 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana | 526 | Open in IMG/M |
3300031910|Ga0306923_11143585 | Not Available | 836 | Open in IMG/M |
3300031910|Ga0306923_11778386 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 634 | Open in IMG/M |
3300031912|Ga0306921_10967346 | Not Available | 962 | Open in IMG/M |
3300031954|Ga0306926_11342489 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 833 | Open in IMG/M |
3300031955|Ga0316035_110349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
3300031956|Ga0316032_106499 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 579 | Open in IMG/M |
3300031965|Ga0326597_10911263 | Not Available | 898 | Open in IMG/M |
3300032001|Ga0306922_11901328 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 583 | Open in IMG/M |
3300032027|Ga0247536_103049 | Not Available | 703 | Open in IMG/M |
3300032035|Ga0310911_10843295 | Not Available | 529 | Open in IMG/M |
3300032051|Ga0318532_10182147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Oribacterium → unclassified Oribacterium → Oribacterium sp. oral taxon 078 → Oribacterium sp. oral taxon 078 str. F0262 | 746 | Open in IMG/M |
3300032059|Ga0318533_10634404 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300032059|Ga0318533_10697887 | Not Available | 745 | Open in IMG/M |
3300032120|Ga0316053_103095 | Not Available | 972 | Open in IMG/M |
3300032160|Ga0311301_10829875 | Not Available | 1262 | Open in IMG/M |
3300032180|Ga0307471_101109372 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 957 | Open in IMG/M |
3300032261|Ga0306920_100175621 | Not Available | 3195 | Open in IMG/M |
3300032261|Ga0306920_101679432 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300032261|Ga0306920_101811850 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 861 | Open in IMG/M |
3300032261|Ga0306920_102075310 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 794 | Open in IMG/M |
3300032515|Ga0348332_10133774 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea | 1414 | Open in IMG/M |
3300032515|Ga0348332_10622449 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1155 | Open in IMG/M |
3300032515|Ga0348332_10750992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
3300032515|Ga0348332_13520631 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 706 | Open in IMG/M |
3300032515|Ga0348332_14135920 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1990 | Open in IMG/M |
3300032756|Ga0315742_13039538 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 541 | Open in IMG/M |
3300032896|Ga0335075_11589889 | Not Available | 538 | Open in IMG/M |
3300034676|Ga0314801_185118 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 524 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.28% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.13% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.68% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.14% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.14% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.84% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.23% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.23% |
Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 1.23% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.07% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.07% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.07% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.92% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.77% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.77% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.77% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.77% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.61% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.61% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.61% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.61% |
Sulfur Spring Sediment And Crust | Environmental → Aquatic → Thermal Springs → Warm (34-42C) → Sediment → Sulfur Spring Sediment And Crust | 0.61% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.61% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.61% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.46% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.46% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.46% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.46% |
Microbial Mats | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats | 0.46% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.31% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.31% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.31% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.31% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.31% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.31% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.15% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.15% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.15% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.15% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.15% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.15% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.15% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.15% |
Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.15% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.15% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.15% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.15% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.15% |
Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 0.15% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.15% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.15% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.15% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.15% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.15% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.15% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.15% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.15% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.15% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.15% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.15% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.15% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.15% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.15% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.15% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.15% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.15% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.15% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.15% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.15% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.15% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.15% |
Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.15% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2077657000 | Sulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B1 | Environmental | Open in IMG/M |
3300000336 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Thermokarst Bog cDNA B3 Metatranscriptome | Environmental | Open in IMG/M |
3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006111 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08 | Environmental | Open in IMG/M |
3300006126 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006355 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006364 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006373 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006378 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006394 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006569 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006691 | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP138 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006712 | Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP1602 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006934 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A1 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300006935 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300006937 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300006938 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A001 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300006939 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
3300008559 | Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-06-47 | Environmental | Open in IMG/M |
3300008578 | Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Powermax_1a | Host-Associated | Open in IMG/M |
3300008584 | Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Control_2a | Host-Associated | Open in IMG/M |
3300008590 | Microbial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Powermax_2a | Host-Associated | Open in IMG/M |
3300008592 | Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Control_1b | Host-Associated | Open in IMG/M |
3300008655 | Microbial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Control_1a | Host-Associated | Open in IMG/M |
3300008661 | Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Control_1a | Host-Associated | Open in IMG/M |
3300008785 | Microbial communities from wetland soil in Czech Republic - R1_cDNA | Environmental | Open in IMG/M |
3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
3300009129 | Combined Assembly of Gp0139513, Gp0139514 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009199 | Microbial communities of wastewater sludge from Singapore - Sludge7_b2_February | Environmental | Open in IMG/M |
3300009203 | Microbial communities of wastewater sludge from Singapore - Sludge9_b2_February | Environmental | Open in IMG/M |
3300009206 | Microbial communities of wastewater sludge from Singapore - Sludge11_b2_February | Environmental | Open in IMG/M |
3300009281 | Microbial communities of wastewater sludge from Singapore - Sludge_b1_October | Environmental | Open in IMG/M |
3300009295 | Microbial communities of wastewater sludge from Singapore - Sludge5_b2_February | Environmental | Open in IMG/M |
3300009348 | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone2_total_RNA | Environmental | Open in IMG/M |
3300009349 | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone2_mRNA | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300009735 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010063 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010064 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010065 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010069 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010072 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010074 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010075 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010078 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010082 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010083 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010086 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010088 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010091 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010092 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010094 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010098 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010100 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010105 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010116 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010121 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010123 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010138 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010349 | AD_HKTAca | Engineered | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010872 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 5) | Environmental | Open in IMG/M |
3300010896 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011031 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 24 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011035 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 23 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011041 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 17 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011049 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 35 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011051 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011057 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011059 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011067 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011300 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 DCM_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011316 | Marine microbial communities from the Southern Atlantic ocean - KN S19 Bottom_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011327 | Marine microbial communities from the Southern Atlantic ocean - KN S19 NADW_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
3300011404 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ035 MetaG | Host-Associated | Open in IMG/M |
3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012693 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES075 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012737 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES003 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012770 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012775 | Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012776 | Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016683 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES128 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019207 | Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
3300020192 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1 | Environmental | Open in IMG/M |
3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021258 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.445 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021266 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.458 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021269 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.499 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021277 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.487 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021299 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021304 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.300 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021313 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.304 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021314 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.671 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021844 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.595 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021852 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.23 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021947 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022166 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022503 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
3300023544 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023656 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023706 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024532 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026565 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027848 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes) | Environmental | Open in IMG/M |
3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028077 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028668 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_120m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
3300029659 | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030525 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO037SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030528 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030532 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030537 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030540 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030543 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030554 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030564 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030569 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030570 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030584 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030589 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030600 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030604 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030605 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE042SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030607 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030624 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030633 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030635 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030684 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030751 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030758 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030774 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030777 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030778 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030782 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 4B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030783 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030784 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030790 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030839 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030843 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030845 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030849 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030852 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030858 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030867 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030920 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030936 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030942 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030947 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030950 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030960 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030970 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030975 | Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030981 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030982 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030986 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031013 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 4A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031015 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031016 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031021 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031039 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031041 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031042 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031047 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031053 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031054 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031055 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031089 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031124 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031484 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031499 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031891 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031955 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031956 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032027 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ZODLETONE_00099710 | 2077657000 | Sulfur Spring Sediment And Crust | LLSFPPATKGVWGMSWRQEAKKGVEDCDKPGGLVKRELIPGYPNDSGMNP |
ZODLETONE_00556880 | 2077657000 | Sulfur Spring Sediment And Crust | TTTPVSWHQEAMKGVEGCDKPGGAVKQALIPGFPN |
ZODLETONE_00037740 | 2077657000 | Sulfur Spring Sediment And Crust | WHQEAMKGVEVCEKLGGVDKQMMIPRFPNQHVLNP |
ZODLETONE_00427330 | 2077657000 | Sulfur Spring Sediment And Crust | HDDWGMSWRQKAKKGVEVCEKLGGVDKRAMIPRFPN |
thermBogB3DRAFT_1012671 | 3300000336 | Soil | PGTWGMSWRQEAMKGVEDCDKPGVAVKRAPIPGFPN* |
Ga0068965_10603412 | 3300004471 | Peatlands Soil | TKGMWGMSRRQEAMKGVENCEKPGGLVKRELIPGYPNNRALNP* |
Ga0008092_100264151 | 3300004629 | Tropical Rainforest Soil | ATKGVWGMSGRQEATKGVEDCDKPGGMVKRVLIPGCPNQPALNP* |
Ga0066687_105488452 | 3300005454 | Soil | ATKGVWGMPRRQKAMKGVEDCDKPGGLVKRELIPGSLNYPDVNP* |
Ga0075024_1000487842 | 3300006047 | Watersheds | VWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGFLN* |
Ga0075024_1008463731 | 3300006047 | Watersheds | VWRISRCQEAMKGVEDCDKPGEAVKRALIPGFLNYCMLNS* |
Ga0075028_1001038982 | 3300006050 | Watersheds | VWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGSLNEHPVNP* |
Ga0007848_10746002 | 3300006111 | Freshwater | VWGMSWRQKAMKGVENCDKPWEAVKRALIQGFPNDRKLNP* |
Ga0007855_11352362 | 3300006126 | Freshwater | VWGMSWRQKAMKGVENCVKPWEAVKRALIQGFPNDRKLNP* |
Ga0075018_101135272 | 3300006172 | Watersheds | VWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGYPN* |
Ga0070712_1018363451 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MWGMSWRQKAMKGVEDCDKPGGTVKQVSSPGFPN* |
Ga0075501_10591332 | 3300006355 | Aqueous | VWGMSWRQKAMKGVEGCEKPGGAVKRALILGSLNYCSLNT* |
Ga0075501_10748752 | 3300006355 | Aqueous | VWGMSWHQKTKKGAENCDKPGGVVKQALIPGFLNKLTLNT* |
Ga0075502_17189151 | 3300006357 | Aqueous | VWGMSWRQKAMKGVEGCEKPGEAVKRALIPGFPNYCTLNT* |
Ga0075482_10326602 | 3300006364 | Aqueous | MSWHQKAKKGVEVCEKPGVVDKRTLIPGFPNQRALNS* |
Ga0075483_10254272 | 3300006373 | Aqueous | MSWRQKAMKGVEGCDKLGGTVKQVLIPRYPNYCMMNP* |
Ga0075483_10508172 | 3300006373 | Aqueous | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNYCMLNT* |
Ga0075483_10700772 | 3300006373 | Aqueous | VWRMSWRQVAMKGVEGCENLGGAVKRALIPRSLNYGILNS* |
Ga0075498_11140042 | 3300006378 | Aqueous | MSWLQEALKGVEDCDKLGVFVKRKLIPRFPNRLAMNT* |
Ga0075498_11199082 | 3300006378 | Aqueous | VWGMFWRQKAMKGVEGCDKPGEAVKRALIPGFPNYRILNT* |
Ga0075492_10007842 | 3300006394 | Aqueous | VWGMSWRQKAMKGVEGCDKPGEAVKRALIPGYPNYRWLNT* |
Ga0075500_1290922 | 3300006569 | Aqueous | VWRMSRRQEAMKGVEGCEKPGVAVKQAIIPGFPNYHVLNP* |
Ga0075522_103549402 | 3300006638 | Arctic Peat Soil | VWGMSWRQKAKKGVENCEKSGGAVKRALIPESLNQPSLNA* |
Ga0031679_10063012 | 3300006691 | Deep Ocean | VWGMSWCQEAMKGVEGCEKPGEAVKRALIPGSLNDRTLNT* |
Ga0031693_10091202 | 3300006712 | Deep Ocean | MSWRQEAMKGVEGCDKPGEAVKRALIPGFPNYRMLNT* |
Ga0066653_104347961 | 3300006791 | Soil | VWGMSWRQEAKKGVEDCDKPGGAVKRALRPGFPNGPTLNP* |
Ga0066665_107130692 | 3300006796 | Soil | VWGMSWRQKAMKGVEDCEKPGVAVTRALIPGYPNDQELNP* |
Ga0066660_108977332 | 3300006800 | Soil | MWGMSRRQQAMKGVEDCDKPGEAVKRALIPGCPNDRRLNP* |
Ga0066660_109976582 | 3300006800 | Soil | VWGMPWHQEAMKGVEDCDKPGGSVKRELIPGSLNDPRVNP* |
Ga0066660_116846382 | 3300006800 | Soil | MWGMSWRQEAMKGVEDCEKPGVAVNRALIPGYPNYRALNP* |
Ga0075428_1002983942 | 3300006844 | Populus Rhizosphere | VWGMPWRQEAKKGVEDCDKPGGSVKRELIPGCPNQPVMNS* |
Ga0063829_10292232 | 3300006860 | Peatlands Soil | MWGMSRRQEAMKGVEDCDKPGGLVKRDLIPGYPNDRALNS* |
Ga0063777_10333492 | 3300006861 | Peatlands Soil | VWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGCPNRRTVNP* |
Ga0063777_10387292 | 3300006861 | Peatlands Soil | VWGMSWRQEATKGAEDCDKSGGAVKRALIPEYPNYPTLNP* |
Ga0073934_104217701 | 3300006865 | Hot Spring Sediment | MSWRQKAMKGVEGCDKPGGAVKQALIPGFPNDRTVNP* |
Ga0073928_110850471 | 3300006893 | Iron-Sulfur Acid Spring | MWGMSWRQEAMKGVEDCEKPAGMVKRVLIPGYPN* |
Ga0075424_1011400161 | 3300006904 | Populus Rhizosphere | MWGMSWRQEAMKGVEDCDKPGEMVKRVLIPGFPNWRVLNP* |
Ga0080680_10526662 | 3300006934 | Tropical Rainforest Soil | VWGMSGRQEAMKGVEDCDKPGGAVKQALSPGCPNHPVVNP* |
Ga0080680_10686872 | 3300006934 | Tropical Rainforest Soil | CGQATKGVWGMSWRQQAMKGVEDCDKPGGAVKRALSPGFLNERGLNP* |
Ga0081246_10558902 | 3300006935 | Tropical Rainforest Soil | VWGMSWRQEAMKGVEDCEKPGGAVKRALMPGFPNQHALNP* |
Ga0081243_10781962 | 3300006937 | Tropical Rainforest Soil | VWGMSWRQQAMKGVEDCDKPGGAVKQALSPGSPNHPA* |
Ga0081243_10937342 | 3300006937 | Tropical Rainforest Soil | VWGMSWRQEARKGVEDCEKPGGAVKRALIPGFPNYPRLNP* |
Ga0081245_10403772 | 3300006938 | Tropical Rainforest Soil | VWGMSRRREARKGVEDCDKPGGAVKRALRPGSPNHRPPNP* |
Ga0081245_10688382 | 3300006938 | Tropical Rainforest Soil | VWGMSRRQEAMKGVEDCDKPGGTVKRVLIPGFPN* |
Ga0081244_10357282 | 3300006939 | Tropical Rainforest Soil | VWGMSWRQEARKGVEDCDKPGGAVKRALRPGCPNQPALNP* |
Ga0081244_10722091 | 3300006939 | Tropical Rainforest Soil | VWGMSWRQKAMKGVEGCDKLGEAVKQALIPGSLNHHAPNP* |
Ga0105055_100112792 | 3300007519 | Freshwater | VWGMSWRQKAMKGVEGCDKPGGAVKRALIPGYPNYRRLNT* |
Ga0105044_107000872 | 3300007521 | Freshwater | VWGMSWHQKAMKGVEGCDKPGEAVKRALIPGFPNDRSLNT* |
Ga0102861_11659232 | 3300007544 | Estuarine | MWGMSWHQKTMKGAENCDNPGGAVKQALRPGYLNELTLNT* |
Ga0105735_10387381 | 3300007860 | Estuary Water | VWGMSWRQKAMKGVEGCEKLGEAVKQALIPGYPNYRILNT* |
Ga0103605_10049742 | 3300008559 | Hydrothermal Vents | MSWRQEAVKGVEVCEKPGGVDKRTVIPGFLNWHVLNT* |
Ga0103649_1002322 | 3300008578 | Host-Associated | MWGMSRRQVAMKGVEGCDKPGGAVKRALIPGSLNYHGLNT* |
Ga0103655_1002112 | 3300008584 | Host-Associated | VWRMSRRQEAMKGVEGCEKPGVAVKQALIPGFPNYHVLNP* |
Ga0103643_1009902 | 3300008590 | Host-Associated | MSRRQQAKKGVKDCEKPGGVVNQALIPGYPNGRQLNP* |
Ga0103654_1003892 | 3300008592 | Host-Associated | MGGGQANKGVWRMSRRQEAMKGVEGCEKPGVAVKQALIPGFPNYHVLNP* |
Ga0103645_1008232 | 3300008655 | Host-Associated | MSRRQKAMKGVEGCDKLGEAVKQALIPRYPNHSMLNT* |
Ga0103653_1006622 | 3300008661 | Host-Associated | MSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT* |
Ga0103653_1011252 | 3300008661 | Host-Associated | TWGRQEAMKGVEDCDKPGGMVKRVLIPGFPNYLGVNP* |
Ga0103638_10004442 | 3300008785 | Wetland Soil | VWGMPWRQEAMKGVEDCDKLGGLVKRELIPRFPN* |
Ga0105048_100344146 | 3300009032 | Freshwater | VWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNDRTLNT* |
Ga0105048_101325922 | 3300009032 | Freshwater | MSWRQETKKGVEVCEKPGEADKQAMIPGSLNAVN* |
Ga0099829_104699322 | 3300009038 | Vadose Zone Soil | MWGMSWRQEAMKGVAGCDKPGGVVKRALIPGFPNYRTLNP* |
Ga0105090_103018552 | 3300009075 | Freshwater Sediment | VWGMSWRQKAMKGVEGCDKPGEVVKRALIPGSLNYRMLNT* |
Ga0099830_113628412 | 3300009088 | Vadose Zone Soil | VWGMSWRQKAMKGVEGCDKLGEAVKQALIPGFPNDRAPNP* |
Ga0099828_112129922 | 3300009089 | Vadose Zone Soil | MWGMSWRQEATKGVAGCDKPGGVVKRALIPGFPNYRTLNP* |
Ga0079224_1014294382 | 3300009095 | Agricultural Soil | MSWRQEAKKGVEVCEKPGEADKQAMIPGFLNTVD* |
Ga0118728_10401382 | 3300009129 | Marine | VIKSVWGMSRRQKAMKGVEGCEKPGGTVKRVLIPGFLNYCVLNP* |
Ga0066709_1026647862 | 3300009137 | Grasslands Soil | VWGMSRRQQAKKGVEDCDKPGGAVKRALIPGCPNDRALNP* |
Ga0099792_106876232 | 3300009143 | Vadose Zone Soil | MWGMSRRQKAMKGVEDCDKPGGTVKRVLIPGFPNYPALNP* |
Ga0103748_100166422 | 3300009199 | Wastewater Sludge | VWGMSWRQEAMKGAEGCEKPGGAVKRALRPGFPNWRGLNT* |
Ga0103748_100420992 | 3300009199 | Wastewater Sludge | VWGMSWRQKAMKGVEGCEKPGEAVKRALIPGSLNYRSLNT* |
Ga0103749_100213172 | 3300009203 | Wastewater Sludge | VWGMSRRQETMKGVEDCEKPGEAVKRALIPGCPNCRMLNP* |
Ga0103749_100252002 | 3300009203 | Wastewater Sludge | VWGMPWRQEAMKGAEDCDKPGGLVKHELIPGFLNAVL* |
Ga0103750_10222791 | 3300009206 | Wastewater Sludge | MSWRQEAKKGVEDCDKLGGLVKRELIPRFPNRRGVNS* |
Ga0103744_101833142 | 3300009281 | Wastewater Sludge | MWGMSWRQEAKKGVEDCEKPGGAVKRASIPGYPNERDLNP* |
Ga0103747_100302661 | 3300009295 | Wastewater Sludge | ATKGVWGMSWRQEAKKGVEDCDKPGGAVKRALRPGYPNRPSLNA* |
Ga0103747_101068642 | 3300009295 | Wastewater Sludge | MWGMSWRQEAMKGVEDCEKLGLAVKRALNPRFPNDCALNP* |
Ga0103786_10029642 | 3300009348 | Microbial Mats | VWGMSRRQKAMKGVEDCDKPRGLVKRELIRGCLNDMH* |
Ga0103786_10029652 | 3300009348 | Microbial Mats | VWGMSRRQKAMKGVEDCDKPRGLVKRELIRGCLNDM* |
Ga0103787_10074082 | 3300009349 | Microbial Mats | VWGMSRRQKAMKGVEDCEKPRGLVKRELIRGSLNDVH* |
Ga0116220_100946332 | 3300009525 | Peatlands Soil | MWGMSRRQEAMKGVENCEKPGGLVKRELIPGYPNNRALNP* |
Ga0105238_117698752 | 3300009551 | Corn Rhizosphere | VWRMSRRWKAMKGVEGCDKLGEAVKQALIPGFPNYHVPNP* |
Ga0105249_125419792 | 3300009553 | Switchgrass Rhizosphere | VWRMSWRQKAMKGVEGCDKLGEAVKQALIPRFPNYHAPNP* |
Ga0105259_10440522 | 3300009597 | Soil | VWGMSWRQEAMKGVEDCDKLGGLVKRELIPRFPN* |
Ga0116125_11295002 | 3300009628 | Peatland | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGFPNVVR* |
Ga0116121_11064342 | 3300009644 | Peatland | MSWRQEALKGVEDCDKPGEVVKRTLIPGFPNWQALNP* |
Ga0105857_12862602 | 3300009650 | Permafrost Soil | MWGMSWRQKAKKGVEDCDKLGGLVKRELIPRSLNHLAVNP* |
Ga0116215_10390482 | 3300009672 | Peatlands Soil | VWGMSWRQEAMKGAEDCDKSGGAVKRALIPEFPNYHGLNP* |
Ga0116224_105434712 | 3300009683 | Peatlands Soil | MWGMSWRQKARKGVEDSDKPGEAVKQALLPGFPNQPALNP* |
Ga0114944_12443002 | 3300009691 | Thermal Springs | TKGVWGMSRRQKAMKGVEDCDKPGGVVKRALIPGCPNERALNP* |
Ga0123377_10112851 | 3300009735 | Marine | KGVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNYCMLNT* |
Ga0131092_102337672 | 3300009870 | Activated Sludge | MWGMSWRQEAMKGVEDCEKLGVAVKRALNPRYPNDCALNP* |
Ga0127462_1675491 | 3300010061 | Grasslands Soil | ANKGVWRMSRRQEAMKGVEGCEKPGVAVKQALIPGFPNYHVLNP* |
Ga0127431_1233941 | 3300010063 | Grasslands Soil | ATKGVWGMSGRQEAMKGVEDCDKPGGTVKRVLIPGCPNQRMLNP* |
Ga0127433_1035512 | 3300010064 | Grasslands Soil | MSWRQKALKGVENCDKPGVIVKQVLIPGFPNWPASNP* |
Ga0127435_1541912 | 3300010065 | Grasslands Soil | MWGMSWRQEAIKGVEDCEKPGGAVKRVLIPGFPT* |
Ga0127467_1056231 | 3300010069 | Grasslands Soil | RQQAMKGVEDCDKPGGLVKRELIPGYPNERTLNP* |
Ga0127467_1272822 | 3300010069 | Grasslands Soil | WGMPWHQEAMKGVEDCDKPGGSVKRELIPGSLNDPAVNP* |
Ga0127428_1042563 | 3300010072 | Grasslands Soil | MSWRQKAMKGVANCDKLGGTVKRVLIPRYPNYPVLNP* |
Ga0127428_1053921 | 3300010072 | Grasslands Soil | WGMSWRQEATKGVENCDKPGEVVKRALIPGSPNQPALNP* |
Ga0127439_1315942 | 3300010074 | Grasslands Soil | TKGVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGCPNYRVLNS* |
Ga0127439_1377852 | 3300010074 | Grasslands Soil | VWGMSRRQEARKGVEDCEKPGGAVKRALRPGCPNHPTLNP* |
Ga0127434_1071652 | 3300010075 | Grasslands Soil | VWGMSWRQKAMKGVEGCEKPGEAVKRALIPGYPNDRTLNP* |
Ga0127434_1272461 | 3300010075 | Grasslands Soil | MSWRQEAMKGVANCDKLGEVVKRTLIPRFPNHRTLNP* |
Ga0127434_1429872 | 3300010075 | Grasslands Soil | MVMGIVAAWRQEAMKGVEDCEKPGGAVKRALRPGFPNRRVLNP* |
Ga0127487_1383642 | 3300010078 | Grasslands Soil | GMWGMSWRQKAMKGVEDCDKLGVAVKQALIPRFPNYRALNP* |
Ga0127469_1396412 | 3300010082 | Grasslands Soil | MWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGFPNEPPLNP* |
Ga0127469_1560581 | 3300010082 | Grasslands Soil | WGMSRRQEAMKGVEDCDKPGEAVKRALIPGSLNQRMLNP* |
Ga0127478_10969702 | 3300010083 | Grasslands Soil | MWGMSWRQEAMKGVEDCDKPGGVVKQALIPGYPN* |
Ga0127496_10359781 | 3300010086 | Grasslands Soil | ATKGVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGYPNYPRLNP* |
Ga0127496_10882243 | 3300010086 | Grasslands Soil | KGVWGMSWRQEAMKGVEDCDKPGGVVKRAMIPGCPNGVR* |
Ga0127476_10243662 | 3300010088 | Grasslands Soil | VWGMSGRQKAMKGVEDCDKPGGMVKRVLIPGCPNNHVLNS* |
Ga0127485_10823562 | 3300010091 | Grasslands Soil | MWGMSWRQEAMKGVEDCEKPGVAVNRALIPGFPNYRALNP* |
Ga0127468_10340142 | 3300010092 | Grasslands Soil | KGVWGMPRRQKAMKGVEDCDKPGGLVKRELIPGSLNYLTVNP* |
Ga0127468_10928472 | 3300010092 | Grasslands Soil | MWGMSWRQEATKGVENCDKPGEVVKRALIPGFPNQAMLNP* |
Ga0127490_10116572 | 3300010093 | Grasslands Soil | VWGMSWRQEARKGVEDCDKPGGAVKRALRPGYPNDRALNP* |
Ga0127480_10452951 | 3300010094 | Grasslands Soil | ATKGVWGMPGRQAAKKGVENCDKLGGAVKRALIPRCPNRPALNK* |
Ga0127473_10183102 | 3300010096 | Grasslands Soil | VWGMSRRQKAMKGVEDCDKPGGAVKRALRPGYPNDQALNP* |
Ga0127473_10563912 | 3300010096 | Grasslands Soil | VWGMSGRQKAMKGVEDCDKPGGTVKRVLIPGCPNHHALNP* |
Ga0127473_10967732 | 3300010096 | Grasslands Soil | WGMSWRQKAMKGVEDCDKLGVAVIRALIPRSLNHRELNP* |
Ga0127463_10961852 | 3300010098 | Grasslands Soil | VWGMSWRQEATKGVEDCEKPGGAVKRALIPGCPNHPRVNP* |
Ga0127450_10476782 | 3300010099 | Grasslands Soil | VWGMSRRQEAMKGAAGCDKPGGAVNEALRPGFPNYRVLNP* |
Ga0127440_10901591 | 3300010100 | Grasslands Soil | GVWGMSRRQEATKGVEDCDKPGEAVKRALIPGFPNQRTLNP* |
Ga0127453_10631322 | 3300010102 | Grasslands Soil | MRGMSRRQEAKKGVEDCEKLGGVVKRTMIPRFPNRRALNP* |
Ga0127453_10674002 | 3300010102 | Grasslands Soil | MPWRQEAMKGVSDCDKPGRAVNEALNPGSPNQRRVNP* |
Ga0127446_10234012 | 3300010104 | Grasslands Soil | VWGMSWRQEATKGVEDCDKPGGAVKRALIPGCPNHPAVNP* |
Ga0127470_10527231 | 3300010105 | Grasslands Soil | RQQAMKGVEDCDKLGGLVKRELIPRSLNYPCVNP* |
Ga0127494_10250492 | 3300010107 | Grasslands Soil | VWGMPRRQQAKKGVEDCDKPGGLVKHELIPGSLNYPGVNP* |
Ga0127460_10715342 | 3300010114 | Grasslands Soil | MWGMSWRQEAMKGVEDCDKPGGAVKRALRPGFPNDHALNP* |
Ga0127466_11173683 | 3300010116 | Grasslands Soil | VWGMSRRQEATKGVEDCEKPGGAVKRAMMPGYPNGQQLNP* |
Ga0127465_10943321 | 3300010118 | Grasslands Soil | KGAWGMSWRQKALKDVEDCDMLGGAVKKVLIPRSPMNLH* |
Ga0127451_10756951 | 3300010120 | Grasslands Soil | GVWGMSGRREAMKGAEGCDKPRGAVKQALIRGYPNDRRLNP* |
Ga0127438_11678322 | 3300010121 | Grasslands Soil | MRGMSRRQEAKKGVEDCEKLGGVVKRTMIPRFPNRRELNP* |
Ga0127479_10448461 | 3300010123 | Grasslands Soil | TKGMWGMSWRQEAMKGVEDCDKPGETVKRVLIPGFPN* |
Ga0127479_11703722 | 3300010123 | Grasslands Soil | GMSWRQEAMKGVEDCDKLGGAAKRALIPRFPNDVR* |
Ga0127486_11696012 | 3300010128 | Grasslands Soil | MWGMSRRQEATKGVEDCDKPGEAVKRALIPGFPNQRTLNP* |
Ga0127459_10435801 | 3300010133 | Grasslands Soil | GMSRRQEAMKGVEDCEKPGGAVKRALRPGSLNYHALNP* |
Ga0115595_10663872 | 3300010138 | Wetland | VWGMSWRQKAMKGVEGCDKPGEVVKRALIPGSLNDRMLNT* |
Ga0127464_11991402 | 3300010139 | Grasslands Soil | MSWRQEAKKGVENCDKPGGAVKRALIPGSLNYRSVNP* |
Ga0127499_11092732 | 3300010141 | Grasslands Soil | RQEAMKGVEDCDKPGGLVKRELIPGSLNYSGVNP* |
Ga0126322_10485392 | 3300010143 | Soil | VWGMSWRQEAMKGVEDCDKPGEAVKRALIPGCPNYRALNP* |
Ga0126321_13046901 | 3300010145 | Soil | TKGVWGMSWRQEAKKGVEDCDNPGGAVKRALRPGCPN* |
Ga0074044_106543762 | 3300010343 | Bog Forest Soil | VWGMSWRQEAMKGVEDCDKLGGLVKRELIPRSLN* |
Ga0116240_106256532 | 3300010349 | Anaerobic Digestor Sludge | VWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNDRILNT* |
Ga0126370_119251532 | 3300010358 | Tropical Forest Soil | MWGMSGRQKAMKGAEDCDKPGEAVKRALRPGFPNDRTLNP* |
Ga0126376_121587662 | 3300010359 | Tropical Forest Soil | VWGMPWRQEAMKGVEDCDKLGELVKRELIPRFPNQLRVNP* |
Ga0105239_109668522 | 3300010375 | Corn Rhizosphere | VWGMPWRQKAMKGVEDCDKLGGLVKRELIPRSLNQLHVNP* |
Ga0136449_1041136442 | 3300010379 | Peatlands Soil | MWGMSWRQEARKGVEDCDKPGGAVKQALSPGFPNDRSVNP* |
Ga0136847_106385932 | 3300010391 | Freshwater Sediment | VWGMSWRQKAMKSVEDCDKPGEAVKRALIPGSSNQRTLNP* |
Ga0126383_112576362 | 3300010398 | Tropical Forest Soil | VWGMSWRQEAMKGVENCDKPGGLVKRELIPGSLNNHVLNP* |
Ga0134121_100853982 | 3300010401 | Terrestrial Soil | VWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGSLN* |
Ga0126354_10738972 | 3300010857 | Boreal Forest Soil | VWGMSWRQEAMKGVEDCDKPGEAVKRALIPGFPN* |
Ga0126354_11541181 | 3300010857 | Boreal Forest Soil | VWGMSWRQKAMKGVEGCEKLGEAVKQALIPRSLNYRAPNP* |
Ga0126352_10641752 | 3300010859 | Boreal Forest Soil | VWGMSGRQKAMKGVEDCDKPGGAVNRALIPGSLN* |
Ga0126351_10586352 | 3300010860 | Boreal Forest Soil | VWGMSGRREAMKGVEGCDKPRGAVKRALIRGYPNDPAPNP* |
Ga0126349_12691032 | 3300010861 | Boreal Forest Soil | MWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRSLNEPSLNP* |
Ga0126349_13065232 | 3300010861 | Boreal Forest Soil | VWGMSWRQEAMKGVEDCDKPGGVVKRALIPGSLNVRELNP* |
Ga0126359_11222112 | 3300010869 | Boreal Forest Soil | VWGMSWRQEAMKGVEGCEKPGEAVKQALIPGFPNVVR* |
Ga0136897_108367832 | 3300010872 | Soil | MWGMSWRQKAMKGVEDCEKPGGMVKRVLIPGSLNERGVNT* |
Ga0138111_10974551 | 3300010896 | Grasslands Soil | GMSRRQEAMKGVEDCEKLGGVVKRTLIPRFPNRPALNP* |
Ga0138543_1320782 | 3300011031 | Peatlands Soil | VWGMSRRQKAMKSVEDCDKPGGAVNRALIPGCPNDRVLNP* |
Ga0138542_1408602 | 3300011035 | Peatlands Soil | MWGMSWRQKAKKGVEDCEKPGEAVKRALIPGYPNQHRLNP* |
Ga0138591_1023181 | 3300011041 | Peatlands Soil | TKGVWGMSWRQEAMKGAEDCDKSGGAVKRALIPEFPNYHGRSQG* |
Ga0138554_1756032 | 3300011049 | Peatlands Soil | MWRMSWRQKAKKGVEDCDKPGGTVKRVLIPGSLN* |
Ga0138540_1136192 | 3300011051 | Peatlands Soil | MWGMSRRQEAKKGVEDCDKPGGAVKQALMPGCPNWSALNP* |
Ga0138544_10934412 | 3300011057 | Peatlands Soil | MWGMSRRQEAKKGVEDCDKPGGAVKQALMPGYPNWSALNP* |
Ga0138597_10355892 | 3300011059 | Peatlands Soil | VWGMSRRQKAMKGVEDCDKPGGPVNRALIPGCPNDRVLNP* |
Ga0138594_10051332 | 3300011067 | Peatlands Soil | VWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGFPN* |
Ga0138595_10165293 | 3300011071 | Peatlands Soil | MWGMSWRQKARKGVEDCDKPGEAVKQALLPGFPNQPALNP* |
Ga0138584_10412842 | 3300011073 | Peatlands Soil | VWGMSRRQKAMKGVEDCDKPGGAVNRAFIPGCPNDRVLNP* |
Ga0138555_10855492 | 3300011075 | Peatlands Soil | VWGMSWRQEAMKGAEDCDKSGEAVKRALIPEFPNYHALNP* |
Ga0138565_11244122 | 3300011078 | Peatlands Soil | MSWRQEALKGVEDCDKPGVVVKRTLIPGYPNWHTLNP* |
Ga0138568_10253382 | 3300011080 | Peatlands Soil | VWGMSCRQEAMKGAEDCDKSGGAVKRALIPEFPNYHGLNP* |
Ga0138568_12028532 | 3300011080 | Peatlands Soil | MWGMSWRQEAMKGVEDCDKPGEAVKRALSPGYPNERVLNP* |
Ga0138575_10389062 | 3300011081 | Peatlands Soil | VWGMSWRQEAMKGVEDCDKPGEAVKRALSPGFPN* |
Ga0138562_12086562 | 3300011084 | Peatlands Soil | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGSLNVIR* |
Ga0138579_11179132 | 3300011090 | Peatlands Soil | MWGMSWRQKAMKGVENCDKPGGAVKRASIPGFPNRRTLNP* |
Ga0150983_120909972 | 3300011120 | Forest Soil | VWGMSWRQEATKGAEDCDKSGGAVKRALIPEFPNYHRLNP* |
Ga0150983_163412902 | 3300011120 | Forest Soil | MWGMSWRQEAMKGVEDCDKLGGLVKRELIPRFPN* |
Ga0137393_102858772 | 3300011271 | Vadose Zone Soil | VWGMSWRQKAMKGVEGCEKLGEAVKQALIPGFPNDRAPNP* |
Ga0138364_11152162 | 3300011300 | Marine | MSWRQVAMKGVEGCEKPGGAVKRALIPGSLNYRTLNL* |
Ga0138399_10226352 | 3300011316 | Marine | VWGMSWCQEAMKGVEGCEKPGEAVKRALIPGSLNYRTLNT* |
Ga0138398_11282972 | 3300011327 | Marine | MWRMSWRQEAMKGVEGCDKPGEAVKRALIPGFPNYRMLNT* |
Ga0151652_127573451 | 3300011340 | Wetland | KGMWGMSWRQEAMKGVANCDKLGEVVKRTLIPRFPNYRTLNP* |
Ga0153951_10431702 | 3300011404 | Attine Ant Fungus Gardens | VWGMSRRQEAMKGVEDCDKPGELVKRELIPGFPNDLRLNS* |
Ga0153943_10690762 | 3300012177 | Attine Ant Fungus Gardens | VWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNHPALNP* |
Ga0153974_11029142 | 3300012180 | Attine Ant Fungus Gardens | VWGMSWRQEATKGVEDCDNPGGAVKRALRPGCPNYRTLNP* |
Ga0153922_11110322 | 3300012181 | Attine Ant Fungus Gardens | VWGMSRRQEAMKGVEDCDKPGGLVKRELIPGFPNGRALNP* |
Ga0137362_108619352 | 3300012205 | Vadose Zone Soil | VWGMSWRQEAMKGVAGCDKPGGVVKRALIPGFPNDRTLNP* |
Ga0137377_107063572 | 3300012211 | Vadose Zone Soil | MWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGYPN* |
Ga0150985_1008323202 | 3300012212 | Avena Fatua Rhizosphere | VWGMSRRQNAMKGVEDCDKLGGMVNRVLIPRFPNYLRVNT* |
Ga0150985_1014491372 | 3300012212 | Avena Fatua Rhizosphere | VWGMSWRQEATKGVEDCDKPGGAVNRALIPGCPNGRTLNP* |
Ga0150985_1059254842 | 3300012212 | Avena Fatua Rhizosphere | VWGMSWRQEAMKGVEDCEKPGGAVKRALIPGCPNDPALNP* |
Ga0150985_1104922081 | 3300012212 | Avena Fatua Rhizosphere | SATKGVWGMSWRQQARKGVEDCDKPGEAVKRALIPGYPNQSDLNP* |
Ga0150985_1111649132 | 3300012212 | Avena Fatua Rhizosphere | MWGMSRRQQAMKGVEDCDKPGETVKQVLRPGFPN* |
Ga0134028_12461092 | 3300012224 | Grasslands Soil | VRIAVNEAQGVWGMSGRREATKGVEGCDKPRGAVKRALIRGFPNDPVPNP* |
Ga0137369_103770762 | 3300012355 | Vadose Zone Soil | MSWRQQATKGVEDCDKPGGSVKRELIPGYPNQPALNP* |
Ga0137360_113355172 | 3300012361 | Vadose Zone Soil | VWGMPRRQQAKKGVEDCDKLGGLVKRELIPRSLNHLRVNP* |
Ga0137390_111258942 | 3300012363 | Vadose Zone Soil | MWGMSWRQEAMKGVAGCDKPGGVVKRALIPGFPNDRTLNP* |
Ga0134027_10709522 | 3300012364 | Grasslands Soil | MPRRQQAMKDVEGCEKPGRAAKQALKPGSPNDRVLNP* |
Ga0134032_10828321 | 3300012376 | Grasslands Soil | ATKGVCGMSWRRQAMKGVEDCDKPGEAVKRALQPGSLNQPTLNP* |
Ga0134023_12499352 | 3300012385 | Grasslands Soil | VWGMSWRQEATKGVEDCDKPGGAVKRALRPGYPNRPALNP* |
Ga0134046_10554602 | 3300012386 | Grasslands Soil | MWGVSGRQEAMKGVEDCDKPGGMVKRVLIPGSLNQPALNP* |
Ga0134040_12020601 | 3300012389 | Grasslands Soil | ATKGMWGMSRRQEAMKGVEDCDKPGGSVKRELIPGSLNDPSVNT* |
Ga0134054_12788431 | 3300012390 | Grasslands Soil | ATKGVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNYPALNP* |
Ga0134024_13733331 | 3300012404 | Grasslands Soil | ATKGVWGMSGRREARKGAADCDKPGGADNRALIPGCPNHRTLNP* |
Ga0134041_12410932 | 3300012405 | Grasslands Soil | VWGMSWRQEAMKGVEDCDKPGEAVKRALIPGFPNYPVLNP* |
Ga0134050_12962552 | 3300012407 | Grasslands Soil | MWGMSWRQEAMKGVEDCDKPGGTVKRVSSPGFPNQRTLNP* |
Ga0150984_1052061712 | 3300012469 | Avena Fatua Rhizosphere | MWGMSWHQKAKKGVEDCDKLGGMVKRVLIPRFPNDPKLNP* |
Ga0150984_1052137392 | 3300012469 | Avena Fatua Rhizosphere | VWGMSRRQKAMKGVEDCDKLGGMVNRVLIPRFPNYLRVNT* |
Ga0150984_1062697002 | 3300012469 | Avena Fatua Rhizosphere | MWGMSRRQQAMKGVEDCDKPGGAVKRALRPGFPNQRTLNP* |
Ga0150984_1091070832 | 3300012469 | Avena Fatua Rhizosphere | MSWRREAKKGVEDCEKLGGAVKRALIPRSLNQHALNP* |
Ga0150984_1200934402 | 3300012469 | Avena Fatua Rhizosphere | MWGMSRRQEAMKGVEDCDNPGGAVKRALRPGYPNDHTLNP* |
Ga0150984_1202939262 | 3300012469 | Avena Fatua Rhizosphere | VWGMSWRQEAMKGVEDCEKPSRAVKRVLTLGFPN* |
Ga0137398_110831462 | 3300012683 | Vadose Zone Soil | MWGMSRRQEAMKGVEDCDKPGEAVKRALIPGSLNQQPLNP* |
Ga0157573_10429482 | 3300012693 | Freshwater | VWRISRCQEAMKGVEDCDKPGEAVKQALIPGFLNDCMLNS* |
Ga0157525_1185572 | 3300012737 | Freshwater | VWGMSWRQKAMKGVEGCDKPGEAVKQALIPGFPNDRALNP* |
Ga0138276_10018441 | 3300012768 | Freshwater Lake | ANKGVWRMSRRQEAMKGVEGCEKPGVAVKQAIIPGFPNYHVLNP* |
Ga0138291_10445092 | 3300012770 | Freshwater Lake | VWGMSWRQKAMKGVEGCDKPGEVVKRALIPGSLNDRMLNK* |
Ga0138280_12150132 | 3300012775 | Freshwater Lake | VWGMSWRQEAMKGVEDCDKPGELVKRELIPGFPNNHALNP* |
Ga0138275_10569342 | 3300012776 | Freshwater Lake | VWGMSWRQKAKKGVEGCDKPGEAVKRALIPGFPNYRTLNT* |
Ga0157283_101450582 | 3300012907 | Soil | VWGMPWRQEAMKGVEDCDKLGGLVKRELIPRSLN* |
Ga0134110_105274412 | 3300012975 | Grasslands Soil | MWGMSRRQEATKGVEDCDKPGGAVKRALIPGSLN* |
(restricted) Ga0172365_101673842 | 3300013127 | Sediment | MSRRQEALKGVEDCEKSGGVVKQALIPEYPNRRTLNP* |
Ga0170791_123743902 | 3300013295 | Freshwater | VWRMSRCQEAMKGVEDCEKPGEAVKQALIPGFLNYCMLNS* |
Ga0120181_11501672 | 3300013766 | Permafrost | VWGMSGRQEAMKGVEDCDNLGGAVNRALRPRSLN* |
Ga0134078_105080202 | 3300014157 | Grasslands Soil | VWGMSWRQEARKGVEDCDKPGGTVKRVLIPGFPN* |
Ga0181532_101421242 | 3300014164 | Bog | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNVVR* |
Ga0181523_100551432 | 3300014165 | Bog | MSWRQEALKGVEDCDKPGEVVKRTLIPGYPNWHALNP* |
Ga0181537_101706902 | 3300014201 | Bog | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNVIR* |
Ga0075341_11061312 | 3300014298 | Natural And Restored Wetlands | VWGMPWRQKAMKGVEDCDKLGGLVKRELIPRSLN* |
Ga0181516_105777982 | 3300014655 | Bog | VWGMSWRQEAMKGVEDCDKPGGAVNRALRPGSLNWRVLNP* |
Ga0182030_103859942 | 3300014838 | Bog | MSWRQEALKGVEDCDKPGEVVKRTLIPGYPNWHALNS* |
Ga0180062_10982771 | 3300014879 | Soil | CGQATKGVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGYPNQRTVNP* |
Ga0173478_104441062 | 3300015201 | Soil | VWRMSRRQEAMKGVEGCDMPGVAVKQAMIPGFPNYHALNP* |
Ga0137409_105447192 | 3300015245 | Vadose Zone Soil | MWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGSLNERRVNP* |
Ga0163144_105955692 | 3300015360 | Freshwater Microbial Mat | MSWRQKAMKGVEGCDKSGEAVKRALIPESLNYRLLNT* |
Ga0132256_1030028092 | 3300015372 | Arabidopsis Rhizosphere | MWGMSWRQKAMKGVEDCEKPGEAVKQALIPGSLNHRTLNP* |
Ga0182035_107184352 | 3300016341 | Soil | VWGMSGRQEAMKGVEGCDKPGEAVKRALIPGSPNHRTLNP |
Ga0180042_1547122 | 3300016683 | Freshwater | VWGMSWRQKAMKGVEGCDKPGEVVKRALIPGSLNDRMLNK |
Ga0181513_11817272 | 3300016700 | Peatland | VWGMPWRQEARKGVEDCDKPGEAVKRALIPGFPNERVLNP |
Ga0181507_10361491 | 3300016705 | Peatland | WGMSWRQEALKGVEDCDKLGGAVKRALIPGYPNWHALNS |
Ga0181505_102706082 | 3300016750 | Peatland | VWGMSWRQKAMKGVEDCEKPGVAVKRALMPGYPNERALNP |
Ga0181505_103577121 | 3300016750 | Peatland | ATKGMWGMSWRQQAMKGVEDCEKPGEAVKRALSPGFPNYSRMNP |
Ga0181505_106673231 | 3300016750 | Peatland | WGMSWRQQAMKGVEDCEKPGVAVTRALSPGSLNDRQLNP |
Ga0181505_109021601 | 3300016750 | Peatland | MPRRQEAMKGVEDCDKPGGLVKRDLIPGSLNYPGVNP |
Ga0187785_106104612 | 3300017947 | Tropical Peatland | MWGMSWRQKAMKGVEDCDKLGVAVKQALIPRFPNYRAMNP |
Ga0187782_103965262 | 3300017975 | Tropical Peatland | VWGMSRRQKAMKGVEDCDKPGGLVKRELIPGCPNDRVLNS |
Ga0187822_103233172 | 3300017994 | Freshwater Sediment | VWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGFPNQRTLNP |
Ga0187788_103694292 | 3300018032 | Tropical Peatland | VWGMSRRQEAMKGVEDCDKPGGLVKRELIPGSPNYHVLNP |
Ga0187887_100441842 | 3300018043 | Peatland | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNDVR |
Ga0187766_109067602 | 3300018058 | Tropical Peatland | VWGMSRRQEAMKGVEDCDKPGGLVKRELIPGSLNHLHVNP |
Ga0187765_104993312 | 3300018060 | Tropical Peatland | VWGMSWRQKAMKGVEGCDKPGEAVKQALIPGSPIVVR |
Ga0187765_111820252 | 3300018060 | Tropical Peatland | VWGMSWRQEATKGAEDCDKSGGAVKRALIPEFPNHHGPNP |
Ga0187770_103875682 | 3300018090 | Tropical Peatland | VWGMSWRQEAMKGVEDCDKPGEAVKRALIPGFPNGQVLNP |
Ga0180034_10858912 | 3300019207 | Estuarine | VWGMSWRQKAMKGVEGCDKPGEAVKRALIPGSLNYRMLNT |
Ga0180110_11487652 | 3300019208 | Groundwater Sediment | MSRRQKAMKGVEGCDKLGEAVKQALIPGFPNDRAPNP |
Ga0180119_12399372 | 3300019228 | Groundwater Sediment | VWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNDRILNT |
Ga0180112_13579481 | 3300019238 | Groundwater Sediment | ATKGVWGMSWRQKAMKGVEDCDKPGGAVKRALIPGSPNQPAPNP |
Ga0181510_13343412 | 3300019240 | Peatland | MWGMSWRQKAKKGVEDCDKPGEAVKRALIPGYPNQRRLNP |
Ga0181508_10828612 | 3300019256 | Peatland | VWGMPRRQEAMKGVEDCDKPGGLVKRDLIPGSLNYPGVNP |
Ga0181504_11112171 | 3300019258 | Peatland | TKGVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGSLNDTH |
Ga0181504_14395462 | 3300019258 | Peatland | KGVWGMSRRQEAMKGVEDCEKPGGLVKRELIPGYPNNRALNP |
Ga0184646_12578972 | 3300019259 | Groundwater Sediment | VWGMSRRQQAMKGVEDCDKPGGAVKRALMPGFPNYRILNP |
Ga0184647_13979022 | 3300019263 | Groundwater Sediment | MWGMSWRWKAMKGVEDCEKLGEAVKQALIPRSLNAAY |
Ga0187796_13851142 | 3300019264 | Peatland | MSWRQEAMKGVEDCDKPGGMVKRVLIPGSLNERVVNP |
Ga0187792_17034232 | 3300019265 | Peatland | VWGMSWRQEAMKGVEDCDKPGVAVKRALIPGYPNERVLNP |
Ga0181514_10213591 | 3300019268 | Peatland | ATKGMWGMSGRQKAMKGVEDCDKPGGAVKRALRPGCPN |
Ga0187794_10637421 | 3300019273 | Peatland | WGMSWRQEATKGVEDCDKPGGAVKRALIPGSLNQPALNP |
Ga0180118_12892032 | 3300020063 | Groundwater Sediment | VWGMSWRQEAMKGVEDCDKLGGMVKRVLIPRSLNHRGVNP |
Ga0184649_11355801 | 3300020068 | Groundwater Sediment | KGVWGMPRRQQAMKGVEDCDKPGGLVKRELIPGSLN |
Ga0206355_14303922 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVLVAKGVWGMSWRQEAMKGVEDCDKRGGAVNRALIPRSLNYLALNP |
Ga0206350_107810441 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | QATKGVWGMSWRQEARKGVEDCDNPGGAVKRALRPGSPNHHPLNP |
Ga0206353_119704531 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | ATKGVWGMPWHQEAMKGAEDCDKRGGAVKRALIPRSLNDPAVNP |
Ga0194049_10076202 | 3300020157 | Anoxic Zone Freshwater | MWGMSWHQKTMKGAENCDNPGGAVKQALRPGYLNELTLNT |
Ga0163147_100357414 | 3300020192 | Freshwater Microbial Mat | VWGMSWRQKAMKGVEGCDKSGEAVKRALIPESLNYRLLNT |
Ga0163150_103764272 | 3300020195 | Freshwater Microbial Mat | MSWRQKALKGVEDCEKLGGIVKRVMIPRFPNKHVLNS |
Ga0194121_100231273 | 3300020200 | Freshwater Lake | MPRRQQAKKGVEDCDKPGGLVKRELIPGSLNHLHVNP |
Ga0179584_10896502 | 3300021151 | Vadose Zone Soil | MWGMSWRQEARKGVEDCDKPGETVKQVLIPGYPNDRVVNP |
Ga0210400_111581942 | 3300021170 | Soil | MWGMSRRQEAMKGVENCEKPGGLVKRELIPGFPNDRALNP |
Ga0210345_1453792 | 3300021258 | Estuarine | MWGMSRRQEAMKGVEDCDKPGELVKRELIPGYPNDRRLNP |
Ga0210348_1141202 | 3300021266 | Estuarine | VWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNYRILNT |
Ga0210348_1237342 | 3300021266 | Estuarine | TKGVWGMSWRQEAMKGVEDCDKPGGLVKRELSPGFPNYRTLNP |
Ga0210356_1438232 | 3300021269 | Estuarine | MSWCQEAIKGVEGCDKLGVAVKQALIPRFPNCRTVNQ |
Ga0210352_1318922 | 3300021277 | Estuarine | VWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNYRTLNT |
Ga0210302_11160072 | 3300021299 | Estuarine | VWGMSWRQKAMKGVEGCDKPGEVVKRALIPGSLNDRMLNT |
Ga0210331_10506982 | 3300021304 | Estuarine | VWGMSWRQKAMKGVEGCDKPGEAVKRALIPGSLNHRMMNT |
Ga0210333_13428782 | 3300021313 | Estuarine | VWGMSWRQKAMKGVEGCDKPGEAVKRALIPGFPNDRTLNT |
Ga0210370_11714042 | 3300021314 | Estuarine | MWGMPWRQEAKKGVEDCEKPGGLVKRELIPGYPNERDVNT |
Ga0213882_100902332 | 3300021362 | Exposed Rock | VWGMSRRQEATKGVEDCDKPGEAVKRALIPGSLNQPALNP |
Ga0213875_102859892 | 3300021388 | Plant Roots | VWGMSGRQEAMKGVEDCDNPGGAVNRALRPGCPNQRVLNP |
Ga0210386_100991732 | 3300021406 | Soil | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNVIR |
Ga0126371_115616262 | 3300021560 | Tropical Forest Soil | VWGMSWRQEARKGVEDCDKPGGAVKRALRPGFPNQRTLNP |
Ga0210361_1416842 | 3300021844 | Estuarine | MSWRQKAMKGVEGCDKLGGTVKQVLIPRYPNYRTMNP |
Ga0210361_1705302 | 3300021844 | Estuarine | VWGMSWRQKAMKGVEGCEKPGVAVKRALIPGFPNYRALNP |
Ga0210317_11380932 | 3300021852 | Estuarine | VDQATKGTWGMSWRRKAMKGVEDCEKPGGVVKRALIPGYLN |
Ga0213851_12527222 | 3300021860 | Watersheds | VWGMPRRQKAKKGVEDCDKLGGLVKRELIPRSLNHLAVNP |
Ga0213851_13783932 | 3300021860 | Watersheds | VWGMSWRQEAMKGAEDCDKPGEAVKRALMPGFPNERRLNP |
Ga0213856_12633292 | 3300021947 | Watersheds | MWGMSRRQVAMKGVEGCDKPGGAVKRALIPGSLNYHGLNT |
Ga0213856_12884052 | 3300021947 | Watersheds | VWGMSWRQEELKDVDDCDKPGGLVKRELIPGYPNDHVLNP |
Ga0213932_10638191 | 3300022166 | Freshwater | ATKGVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNYHGVNP |
Ga0242644_10071212 | 3300022498 | Soil | MWGMSRRQEAKKGVEDCDKPGGAVKQALMPGCPNWSALNP |
Ga0242644_10124512 | 3300022498 | Soil | VGVLLVRWGMSWRQEAMKGVEDCEKPGEAVKRALIPGYPNRPRLNP |
Ga0242644_10125661 | 3300022498 | Soil | ATKGMWGMSGRQKAMKGVEDCDKPGQAVKRALTPGFPNYPTLNP |
Ga0242644_10375651 | 3300022498 | Soil | VWGMSWRQEATKGAEGCDKLGGAVKRALIPRYPNHHALNP |
Ga0242641_10107202 | 3300022499 | Soil | MSRRQKAKKGVEDCEKPGGAVKRALMPGYPNRHALNP |
Ga0242641_10108411 | 3300022499 | Soil | QATKGMWGMSWRQEAMKGVEDCDKPGEMVKRVMIPGYPNERVLNP |
Ga0242641_10128012 | 3300022499 | Soil | MSGRQKAMKGAEDCDKSGEAVKRALIPEYPNRHALNP |
Ga0242641_10305052 | 3300022499 | Soil | WGMSWRQEAMKGVEDCDKPGGTVKQVSSPGFPNQRTLNP |
Ga0242641_10466512 | 3300022499 | Soil | WGMSWRQEAKKGVEDCEKPGGAVKRALIPGYPNERVLNP |
Ga0242643_1014352 | 3300022500 | Soil | MWGMSWRQEAKTGVEGCEKPGEAVKRALIPGFPNYLALNQ |
Ga0242643_1055753 | 3300022500 | Soil | GMSRRQEAMKGVEDCDKPGELVKRELIPGYPNYHVLNS |
Ga0242643_1136202 | 3300022500 | Soil | MWGMSRRQQAMKGVEDCDKPGETVKQVLIPGFPNGYPLNP |
Ga0242645_10062332 | 3300022501 | Soil | VWGMPWHQEAMKGVEDCDKPGGSVKRELIPGYLNDSGMNP |
Ga0242645_10232441 | 3300022501 | Soil | MSWRQEATKGAEDCDKPGGAVKQALRPGFPNQRMLNP |
Ga0242645_10306442 | 3300022501 | Soil | MWGMSWRQKAKKGVEDCEKPGEAVKRALIPGYPNRLRLNP |
Ga0242646_10295491 | 3300022502 | Soil | TKGMWGMSWRQEATKGVEDCDKLGGVVKRTLIPRYPN |
Ga0242650_10073532 | 3300022503 | Soil | MWGMSRRQEAMKGVENCEKPGGLVKRELIPGFPNNRALNP |
Ga0242650_10147051 | 3300022503 | Soil | VTKGMWGMSRRQEAMKGVEDCDKPGGLVKRELIPGYPNDPALNP |
Ga0242642_10015003 | 3300022504 | Soil | KGMWGMSRRQEAMKGVENCEKPGGLVKRELIPGYPNNRALNP |
Ga0242642_10035541 | 3300022504 | Soil | IKGVWRMSRRQEAMKGVEDCDKPGEAVKRALIPGFLNYCMLNS |
Ga0242642_10084032 | 3300022504 | Soil | VWGMSGRQEAMKGVEDCDKPGGAVKQALSPGCPNYRVLNP |
Ga0242642_10093753 | 3300022504 | Soil | ATKGVWGMSWRQEATKGAEDCDKSGGAVKRALIPEFPNYHMLNPIGV |
Ga0242642_10104802 | 3300022504 | Soil | VWGMSWRQEAMKGVEDCDKLGGVVKRALIPRSLNQHRLNP |
Ga0242642_10104972 | 3300022504 | Soil | ATKGVWGMSWRRQAMKGVEDCDKPGGVVKRALIPGSLNYPGLNP |
Ga0242642_10192241 | 3300022504 | Soil | KGMWGMSWRQEAMKGVADCDKPGGVVKRTLIPGCPNQHVLNP |
Ga0242642_10279872 | 3300022504 | Soil | MWGMSWRQEAMKGVEDCDKPGGVVKRALIPGFPNYRVLNP |
Ga0242642_10417662 | 3300022504 | Soil | GMSWRQEAMKGVEDCDKPGEAVNRALIPGFPNYRQLNP |
Ga0242642_10538252 | 3300022504 | Soil | MWGMSRRQEAMKGVEDCEKPGELVKRELIPGFPNNRALNP |
Ga0242642_10571703 | 3300022504 | Soil | TKGVWGMSRRQKAMKGVEDCDKPGEAVKRALIPGCPNYRVLNP |
Ga0242642_10762521 | 3300022504 | Soil | KGVWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRSLNQPWLNP |
Ga0242642_10802792 | 3300022504 | Soil | MWGMSGRQQAMKGVEDCDKPGEVVKRALIPGFPNYRALNP |
Ga0242642_10997982 | 3300022504 | Soil | VWGMSWRQEATKGVEDCDKPGGLVKRELIPGFPNYQALNP |
Ga0242642_11030391 | 3300022504 | Soil | ATKGVWGMSWRRQAMKGVEDCDKPGEAVKRALRPGFPNDPALNP |
Ga0242647_10015592 | 3300022505 | Soil | WHQEAMKGVEDCDKPGGSVKRELIPGYLNDSGMNP |
Ga0242647_10087862 | 3300022505 | Soil | GMWGMSWRQEAMKGVEDCDNPGGAVNRALRPGSLN |
Ga0242647_10220342 | 3300022505 | Soil | VWGMSWRQEAMKGVEDCEKPGGAVKRALIPGYPNERVLNP |
Ga0242648_10077621 | 3300022506 | Soil | TKGVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGSLN |
Ga0242648_10371101 | 3300022506 | Soil | KGVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNQF |
Ga0242648_10453762 | 3300022506 | Soil | GMSGRQEATKGVEDCDKPGGAVKRALRPGYPNQRVLNP |
Ga0222729_10016451 | 3300022507 | Soil | ASKGVWGMSWRQEAMKGVEDCEKPGGAVKRALILGSLNQRMLNP |
Ga0222729_10057061 | 3300022507 | Soil | ATKGMWGMSWRQKAMKGVEDCDKLGEAVKRALIPRGNHV |
Ga0222729_10071921 | 3300022507 | Soil | KGRWGMSWRQEATTGVEDCDKPGEAVKRALIPGSLNQRALNS |
Ga0222729_10368862 | 3300022507 | Soil | VWGMPRRQKAMKGVEDCEKPGEAVKRALIPGYPNWPMLNP |
Ga0222729_10538982 | 3300022507 | Soil | VTKGVWGMSRRQEARKGVEDCDKPGGLVKRELIPANTEDPEF |
Ga0222729_10558021 | 3300022507 | Soil | ATKGVWGMSWRQEAMKGVEDCDKPGEAVKRALIPGSLN |
Ga0222728_10278062 | 3300022508 | Soil | ATKGMWGMSWRQEAMKGVEDCDKPGGVVKRTLIPGSLN |
Ga0222728_10316981 | 3300022508 | Soil | GMSWRQEAMKGVEDCDKPGEAVKRALIPGCPNYRTLNP |
Ga0222728_10462792 | 3300022508 | Soil | VWGMSWRQETMKGVEDCEKPGGAVKQALMPGCPNWSALNP |
Ga0222728_10574501 | 3300022508 | Soil | GMWGMSRRQEATKGVEDCDKPGGAVKRALIPGCPNQRVLNP |
Ga0222728_10849511 | 3300022508 | Soil | MSWRQEAMKGVEDCDKPGETVKRVLIPAYFARVFGR |
Ga0242649_10065742 | 3300022509 | Soil | WGMSWRQEAMKGVEDCDKPGGAVKRALRPGSLNYPTLNP |
Ga0242649_10068692 | 3300022509 | Soil | VWGMPWRQEATKGVEDCDKPGEAVKRALIPGSLNWRTLNP |
Ga0242649_10109921 | 3300022509 | Soil | WGMSWRQQAMKGVEDCDKPGGAVKRALSPGYPNYRGPNP |
Ga0242649_10279451 | 3300022509 | Soil | GMWGMSRRQQAMKGVEDCDKPGGAVTRALRPGFPN |
Ga0242649_10330451 | 3300022509 | Soil | GVWGMSWRQEAMKGVEDCDKPGGAVNRALRPGSLN |
Ga0242649_10545342 | 3300022509 | Soil | VWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNQRSVNP |
Ga0242649_10561812 | 3300022509 | Soil | SWRQKAMKGVEDCDKPGGMVKRVLIPGSLNYRALNP |
Ga0242649_10724102 | 3300022509 | Soil | VWGMPWRQEAMKGVEDCDKPGELVKRELIPGFPNYLGVNP |
Ga0242649_10729531 | 3300022509 | Soil | TKGMWGMSWRQKAMKGVEDCDNPGGVVKRALIPGYPH |
Ga0242652_10330661 | 3300022510 | Soil | WGMSWRQEAMKGVEDCDKPGEVVKRTLIPGFPNWRTLNP |
Ga0242651_10201202 | 3300022511 | Soil | KGVWGMSRRQKAMKGVEDCDKPGGAVNRALSPGCPNHRVLNP |
Ga0242651_10222712 | 3300022511 | Soil | MWGMSWRQKAMKGVENCDKPGGVVKRASMPGFPNQPTLNP |
Ga0242651_10479291 | 3300022511 | Soil | GMSWRQEAMKGVEDCDKPRGAVTQALSPGYPNRPELNP |
Ga0242667_10395471 | 3300022513 | Soil | ATKGVWGMSGRQEAMKGVEDCDNPGGAVNQALRPGSLN |
Ga0242659_10270322 | 3300022522 | Soil | MWGMSRRQEAMKGVEDCDKPGGLVKRELIPGYPNYHVLNS |
Ga0242659_10278572 | 3300022522 | Soil | MSRRQETMKGVEDCDKPGGAVKRALMPGYPNWRVLNP |
Ga0242659_10395052 | 3300022522 | Soil | VWGMSGRQEAMKGVEDCDNLGGAVNRALRPRSLNDCTLNP |
Ga0242659_10757191 | 3300022522 | Soil | TKGMWGMSWRQEAMKGVEDCDKPGEAVKRALIPGFPNERVLNP |
Ga0242663_10032671 | 3300022523 | Soil | KGVWGMSGRQKAMKGAEDCDKPGEAVKRALRPGSPNHQPPNP |
Ga0242663_10631931 | 3300022523 | Soil | TKGTWGMSWRQEAMKGVEDCDKPGEAVKQALIPGSLNAPELNP |
Ga0242663_10779962 | 3300022523 | Soil | VWGMSGRQEAMKGVEDCDNLGGAVNRALRPRSLNYCTLNP |
Ga0242663_10873542 | 3300022523 | Soil | VWGMSWRQKAMKGVEGCDKLGEAVKQALIPRSLNYRAPNP |
Ga0242664_10820732 | 3300022527 | Soil | VWGMSRRQEAKKGVEDCDKPGGLVKRDLIPGYPNDPTLNS |
Ga0242669_11119881 | 3300022528 | Soil | ATKGMWGMSWRQKAMKGVEDCDKPGGTVKRVLIPGSLN |
Ga0242668_10976002 | 3300022529 | Soil | ATKGVWGMSWRQEATKGVEDCDKPGEAVKRALIPGCPNQRTLNP |
Ga0242658_10212272 | 3300022530 | Soil | VWGMSWRQKAMKGVEGCEKPGEAVKRALIPGFPNVVH |
Ga0242658_11366571 | 3300022530 | Soil | TKGVWGMPWRQEAMKGVEDCDKLGGLVKRELIPRSLN |
Ga0242658_11498022 | 3300022530 | Soil | SWRQEAMKGVEDCDKPGGAVNRALRPGSLNQHVPNP |
Ga0242658_11781482 | 3300022530 | Soil | GVWGMSRRQEAMKGVEDCDKPGGLVKRELIPAQKSQH |
Ga0242660_10482582 | 3300022531 | Soil | GVWGMSWRQEAMKGVEDCEKPGGAVKRALRPGYPN |
Ga0242660_10601091 | 3300022531 | Soil | WGMSWRKEAMKGVDDCDKPGGAVNQALSPGSLNQPSLNP |
Ga0242660_11050433 | 3300022531 | Soil | WGMPRRQQAKKGVEDCDKLGGLVKRELIPRSLNHLHVNP |
Ga0242660_12119642 | 3300022531 | Soil | GVWGMSWRQEAKKGVENCDKPGEVVKRALIPGFPN |
Ga0242655_100574601 | 3300022532 | Soil | KGVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGCPNYPALNP |
Ga0242655_101895022 | 3300022532 | Soil | KGMWGMSWRQKAMKGVEDCDKLGEAVKRALIPRFPNWHELNP |
Ga0242655_102295361 | 3300022532 | Soil | ATKGMWGMSRRQEAKKGVEDCEKPGGAVKRALMPGCPNRLVLNP |
Ga0242662_102131922 | 3300022533 | Soil | VWGMPWHQEAKKGVEDCDKPGGSVKRELIPGFLNDPAVNT |
Ga0242670_10149161 | 3300022708 | Soil | ATKGMWGMSWRQEAKTGVEGCEKPGEAVKRALIPGFPNYLALNQ |
Ga0242670_10180952 | 3300022708 | Soil | VWGMSWRQEAMKGVEGCEKPGEAVKQALIPGFPNVVR |
Ga0242670_10292652 | 3300022708 | Soil | SRRQKAMKGVEDCDKPGEAVKRALIPGFPNDRVLNP |
Ga0242674_10519602 | 3300022711 | Soil | MSWRQEALKGVEDCEKLGGIVKRVLIPRYPNWHALNS |
Ga0242653_10125843 | 3300022712 | Soil | MYWRQRAMKGVEGCDKLGEAVKQALIPGFPNDRAPNP |
Ga0242677_10104982 | 3300022713 | Soil | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGFPNVAY |
Ga0242677_10625452 | 3300022713 | Soil | MSRRQKAKKGVEDCEKPGGAVKRALMPGYPNRQALNP |
Ga0242673_10309132 | 3300022716 | Soil | VWGMSWRQEAMKGVEDCDKPGGAVNRALRPGYPNEHVLNP |
Ga0242673_10311751 | 3300022716 | Soil | ATKGMWGMTWRQLAMKGVEDCDKPGEAVTRALNPGFPNQYALNL |
Ga0242673_10612591 | 3300022716 | Soil | KGVWGMSRRQEAMKGVEDCDKPGGAVKQALIPGCPN |
Ga0242661_10087971 | 3300022717 | Soil | KGVWGMAWLHEAMKGVDDCDNPGGAVNRALRPGSLH |
Ga0242661_10270662 | 3300022717 | Soil | GMPWRQEAMKGVEDCDKPGELVKRELIPGFPNCSGVNP |
Ga0242661_10271293 | 3300022717 | Soil | WGMSGRQKAMKGAEDCDKSGEAVKRALIPEYPNWHVLNS |
Ga0242661_10349812 | 3300022717 | Soil | MSWRQEAMKGVEDCDKPGGAVKRALIPGSLNYRTLNP |
Ga0242661_10550952 | 3300022717 | Soil | KGVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGSLN |
Ga0242661_10593122 | 3300022717 | Soil | WRQEAMKGVEDCDKPGETVKRVLIPGFPNGRTLNP |
Ga0242661_10852691 | 3300022717 | Soil | GMSWRQEAMKGVEDCDKPGEAVKRALIPGSLNQRTLNP |
Ga0242661_11524942 | 3300022717 | Soil | KGMWGMSWRQEAMKGVEDCDKLGEAVKRALIPRFPNDVN |
Ga0242661_11574261 | 3300022717 | Soil | TKGTWGMSRRQKAKKGVEDCDNPGGAVKRALIPGSLN |
Ga0242675_10043072 | 3300022718 | Soil | MWGMSGRQEAMKGVEDCDKPGEAVKRAMIPGSLNEQRLNP |
Ga0242675_10204472 | 3300022718 | Soil | WGMPWRQEAKKGVADCEKLGGLVKRELIPRSLTYLRVNP |
Ga0242672_10250791 | 3300022720 | Soil | KCVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNYPTLNP |
Ga0242672_10374821 | 3300022720 | Soil | GMWGMSWRQEAIKGVEDCEKPGVVVNRALIPGFPNYRALNP |
Ga0242657_11543292 | 3300022722 | Soil | MSWRQEALKGVEDCEKLGGIVKRVLIPRFPNWHALNS |
Ga0242657_12283041 | 3300022722 | Soil | KGMWGISWRQEAMKGVEDCDKPGEAVKQALIPGFPNDRSVNP |
Ga0242665_100660032 | 3300022724 | Soil | MSGRQEAKKGVEDCDKPGGMVKRVLIPGSLNQRALNP |
Ga0242665_103575881 | 3300022724 | Soil | GRWGMSGRQKAMKGAEDCDKPGGAVKRALRPGSLNDLVIFG |
Ga0242654_101523001 | 3300022726 | Soil | QATKGVWGMSGRREAMKGVEDCDKPGEAVKRALRPGFPNQHALNP |
Ga0242654_102603342 | 3300022726 | Soil | MWGMSWRQEAMKGVEDCDKPGEAVKRALIPGYPNDRVVNP |
Ga0242654_102688562 | 3300022726 | Soil | TKGVWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNYPALNP |
Ga0242654_102729622 | 3300022726 | Soil | TKGVWGMPWRQEAMKGVEDCDKPGELVKHELIPGFPNYSGVNP |
Ga0242654_102755951 | 3300022726 | Soil | KGMWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRSLNQPWLNP |
Ga0242654_102904672 | 3300022726 | Soil | GMPRRQKAMKGVEDCDKPGGLVKRELIPGSLNQHHVNP |
(restricted) Ga0233424_100041665 | 3300023208 | Freshwater | VWGMPWRQEAMKGVEDCEKLGGLVKRELIPRSLNQPDVNP |
Ga0247542_1026131 | 3300023544 | Soil | KGVWGMPWRQEAMKGVEDCDKLGGLVKRELIPRSLNYPRLNP |
Ga0247547_1021962 | 3300023656 | Soil | VWGMSWRQKAMKGVEGCDKLGEAVKQALIPGFPNDRAPNP |
Ga0232123_10534102 | 3300023706 | Salt Marsh | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNYCMLNT |
Ga0256352_10431562 | 3300024532 | Freshwater | VWGMSWHQKTKKGAENCDKPGGVVKQALIPGFLNKLTLNT |
Ga0209172_101168522 | 3300025310 | Hot Spring Sediment | VWGMPRRQEAMKGVEDCDKPGGLVKRELIPGCPNQRGVNS |
Ga0209323_107131392 | 3300025314 | Soil | VWGMSRRQEATKGVEGCDKPGEAAKRALIPGFPNDRMLNP |
Ga0208005_11726612 | 3300025848 | Aqueous | VWGMSWRQKAMKGVEGCEKPGGAVKRALILGSLNYCSLNT |
Ga0207694_1000196510 | 3300025924 | Corn Rhizosphere | VRRISRRQEAMKGVEDCDMPGEAVKRALIPGFLNYCMLNS |
Ga0207668_113991312 | 3300025972 | Switchgrass Rhizosphere | VWGMSWRQKAMKGVEDCDKPGVAVNRALIPGFPNDRALNP |
Ga0209848_10183192 | 3300026221 | Permafrost Soil | VWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNYLHVNP |
Ga0209805_11522072 | 3300026542 | Soil | VWGMSWRQEAKKGVEDCDKPGEMVKRVLIPGYPNWHPVNP |
Ga0209805_11831502 | 3300026542 | Soil | VWGMSRRQQAKKGVEDCDKPGGAVKRALIPGCPNDRALNP |
Ga0179587_108134072 | 3300026557 | Vadose Zone Soil | VWGMSWRQEAMKGVEDCDKPGGTVKRVLIPGFPNEYTLNP |
Ga0256311_10284302 | 3300026565 | Freshwater | VWRMSRRQEAMKGVEGCEKPGVAVKQAIIPGFPNYHVLNP |
Ga0207855_10322692 | 3300027039 | Tropical Forest Soil | VWGMSWRQEAMKGVEDCDKPGEAVKRALMPGFPNECTLNP |
Ga0208042_10089642 | 3300027568 | Peatlands Soil | VWGMSWRQEAMKGAEDCDKSGGAVKRALIPEFPNYHGLNP |
Ga0207826_12258372 | 3300027680 | Tropical Forest Soil | MSWRQEALKGVEDCDKPGVVVKRALIPGYPNWRTLNP |
Ga0208991_10451492 | 3300027681 | Forest Soil | VWGMPRRQEAMKGVEDCDKLGGLVKRELIPRSLNQHGVNP |
Ga0209390_100101852 | 3300027848 | Freshwater | VWGMSWRQKAMKGVEGCDKPGGAVKRALIPGYPNYRRLNT |
Ga0209591_104333652 | 3300027850 | Freshwater | VWGMSWHQKAMKGVEGCDKPGEAVKRALIPGFPNDRSLNT |
Ga0209168_106019092 | 3300027986 | Surface Soil | MWGMSRRQEAMKGVEDCDKPGGLVKRDLIPGFPNDPVLNS |
Ga0256323_10261581 | 3300028077 | Freshwater | IHKGVWGMSWRQKAMKGVEGCEKLGEAVKQALIPGFPNYRMLNT |
Ga0256305_10113133 | 3300028108 | Freshwater | WGMSWRQKAMKGVEGCEKLGEAVKQALIPGFPNYRMLNT |
Ga0247822_102846752 | 3300028592 | Soil | MSWLQEALKGVEDCDKPGVFVKRKLIPGFPNRPAMNT |
Ga0257140_10289172 | 3300028668 | Marine | MSRRQESTKGVVGCDKLREAVKRALIRRSPNHLLLNS |
(restricted) Ga0247842_101227002 | 3300029268 | Freshwater | VWRMSRCQEAMKGVEDCEKPGEAVKRALIPGFLNYCMLNS |
Ga0206094_1100171 | 3300029659 | Soil | KGVWGMPWRHEALKGVADCDKPGGMVKRVLIPGFPN |
Ga0299907_109837872 | 3300030006 | Soil | MSWRQKAMKGVEGCEKPGEAVKRALIPGFPNARVLNP |
Ga0302179_103257042 | 3300030058 | Palsa | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGYPNVVR |
Ga0210273_11506962 | 3300030525 | Soil | MWGMSRRQKAKKGVEDCEKPGGAVKQALTPGYPNRRTLNP |
Ga0210277_103772772 | 3300030528 | Soil | VWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNYLRVNP |
Ga0210277_105250171 | 3300030528 | Soil | GQATKGVWGMPWRQEAMKGVEDCDKLGGLVKRELIPRSLNYPRLNP |
Ga0210290_12006011 | 3300030532 | Soil | QCGQATKGVWGMSGRQEAMKGVEDCDNPGGAVNRALRPGSLN |
Ga0247642_10245261 | 3300030537 | Soil | GTWRMSWRQKAMKDVEGCDKPGRAAKQALKPGSPN |
Ga0247649_10503792 | 3300030540 | Soil | SWRQKAMKGVEGCEKPGRAAKQALKPGYPNDRALNS |
Ga0247649_10939131 | 3300030540 | Soil | GQATKGVWRMSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT |
Ga0210289_13202941 | 3300030543 | Soil | QATKGMWGMSWRQKAMKGVEDCDKPGGTVKRVLIPGSLN |
Ga0210271_108868481 | 3300030545 | Soil | GQATKSMWGMSWRQKAMKGVEDCDKPGEAVKRAMIPGSLN |
Ga0247640_11077891 | 3300030554 | Soil | ATKGMWGMSWRQEAKKGVEDCDKPGEAVKRASIPGSLNYHNLNP |
Ga0210256_103266862 | 3300030564 | Soil | VWGMSWRQEAMKGVEDCEKPGGAVKRVLMPGCPNRRVLNP |
Ga0247628_11243062 | 3300030569 | Soil | VRGMSWRQEAMKGVEDCENPGGAVKRASMPGSPNQHALNP |
Ga0247647_11696041 | 3300030570 | Soil | TWGMSWRQEALKGVEDCEKLGGIVKRVLIPRFPNWHTLNP |
Ga0247658_11424161 | 3300030584 | Soil | GQVTKGIRGMSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT |
Ga0210255_101836591 | 3300030589 | Soil | RMSRRQDAMKGVEDCDKPGEAVKRALIPGFLNYRILNS |
Ga0210278_10483502 | 3300030596 | Soil | LWRMSRRQEAMKGVEDCDKPGEAVKRALIPGFLNYCMLNS |
Ga0210287_10906541 | 3300030598 | Soil | QATKGMWGMSWRQKAMKGVEDCDKPGGAVNRALRPGCPN |
Ga0247659_12269501 | 3300030600 | Soil | RGMSRRQKAMKGVEGCDKLGEAVKQALIPRYPNHSMLNT |
Ga0210254_104908602 | 3300030602 | Soil | VWGMSRRQEAKKGVEDCEKPGGAVKQALRPGYPKCVS |
Ga0247637_12004331 | 3300030604 | Soil | GMWGMSGRQEATKGVEDCDNPGGAVKRALRPGSPNHPVLNP |
Ga0210265_11306502 | 3300030605 | Soil | VWGMSRRQEAKKGVEDCDKPGGLVKRELIPGYPNDPALNS |
Ga0247615_103741661 | 3300030607 | Soil | GAWGMSWRQKTMTGVEDCEKPGEAVKQALIPGYPNKLLLNP |
Ga0210251_110800311 | 3300030624 | Soil | GVWGMSRRQEAKKGVEDCDKPGGLVKRELIPGSLNYPALNP |
Ga0210268_12217662 | 3300030629 | Soil | MSWRQEALKGVENCEKLGGTVKRVLSPRFPNWSALNP |
Ga0247623_100285352 | 3300030633 | Soil | VWGMSWRQKAMKGVEGCDKSGEAVKRALIPESLNYR |
Ga0247623_103256331 | 3300030633 | Soil | QVTKGIRGMSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT |
Ga0247627_101846372 | 3300030635 | Soil | VDPGGQATKGVWGMPWRQEAMKGVEDCDKPGGMVKRVLIPGSPNYRRLNP |
Ga0247617_11499191 | 3300030684 | Soil | VTKGIRGMSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT |
Ga0265460_109602971 | 3300030740 | Soil | QANKGMWRMSRRQEAMKGVEDCEKPGEAVKQALIPGFPNYLMLNP |
Ga0265460_129664372 | 3300030740 | Soil | VWGMSWRQEAKKGVEDCEKPGGAVKRALIPGYPNRHALNP |
Ga0265459_109795062 | 3300030741 | Soil | MWGMSRRQEAKKGVEDCEKPGGAVKQALMPGCPNWSALNP |
Ga0265459_132559512 | 3300030741 | Soil | VWGMSRRQEAKKGVEDCDKPGGLVKRELIPGYPNYRTLNS |
Ga0102764_19420931 | 3300030751 | Soil | WRQEAMKGVEDCDKLGGLVKRELIPRSLNQRVVNP |
Ga0138305_15591672 | 3300030758 | Soil | GGQANKGVWRMSRRQEAMKGVEGCEKPGVAVKQALIPGFLNYHVLNP |
Ga0265762_10681701 | 3300030760 | Soil | WGMSWRQKAMKGVEGCDKLGEAVKQALIPGFPNDRAPNPYVHEANAVT |
Ga0265763_10317671 | 3300030763 | Soil | KSMWGMSRRQEAMKGVDDCDKPGGLVKRELIPGSLNYHGVNP |
Ga0074007_101525432 | 3300030774 | Soil | VWGMSWHQKAKKGVEDCEKPGGAVKRALNPGCPNQPALNA |
Ga0075402_101372172 | 3300030777 | Soil | VWGMSRRQEARKGVEDCDKPGGAVKRALIPGSPNGRTLNP |
Ga0075402_123199342 | 3300030777 | Soil | VWGMSWHQKAKKGVEDCEKPGGAVKRAMNPGYPNQPALNA |
Ga0075402_124782802 | 3300030777 | Soil | MWGMSWRQKAMKGVADCDKLGGTVKRVLIPRYPNAMY |
Ga0075398_100531932 | 3300030778 | Soil | VWGMSRRQEARKGVEDCDKPGGAVKRALIPGFPNGPTLNP |
Ga0075398_122183602 | 3300030778 | Soil | VWGMSWRQEAKKGVEDCDKPGGAVNRALRPGCPNCRVLNP |
Ga0102754_10598892 | 3300030782 | Soil | VWGMSRRQEAMKGAENCEKPGGAVKQALMPGYPNGRKLNP |
Ga0102752_10303362 | 3300030783 | Soil | MSWCQEAMKDAVGCDNPGRAANRALKPGSPNDRALNP |
Ga0102758_100880041 | 3300030784 | Soil | MSWRQEAMKGVEDCDKLGEVVKQALIPRYPNYHALNP |
Ga0138304_10269642 | 3300030790 | Soil | VWGMPRHQEAKKGVEDCDNPGEAVKRALIPGSLNHPALNP |
Ga0308203_10357621 | 3300030829 | Soil | TKGVWGMSRRQEAMKGVEDCEKPGGAVKRALRPGSLNQRALNA |
Ga0308205_10210962 | 3300030830 | Soil | RRQEAMKGVEDCEKPGGAVKRALRPGSLNQRALTA |
Ga0308152_1120721 | 3300030831 | Soil | WRQEAKKGVEDCDNPGGAVKRALIPWCPNYPALNP |
Ga0073999_101351082 | 3300030839 | Soil | VWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRSLNVPSLNP |
Ga0075392_100658222 | 3300030843 | Soil | MWGMSWRQKAMKGVEDCEKPGEAVKRALIPGSLNQRRLNP |
Ga0075397_100545302 | 3300030845 | Soil | MWGMSWRRQAMKGVEDCDKSGGAVKRALMPEYPNRRVLNP |
Ga0075388_100924742 | 3300030848 | Soil | VWGMSRRQEARKGVEDCDKPGGAVKRAMIPGFPNEPTLNP |
Ga0075393_100853992 | 3300030849 | Soil | VWGMSWRQEAMKGVEDCDKPGGAVKRALIPGCPNYPTLNP |
Ga0075389_100681422 | 3300030852 | Soil | VWGMSRRQKAKKGVEDCEKPGGAVKRALRPGYPNERELNP |
Ga0075385_100494131 | 3300030854 | Soil | QATKGMWGMSWRRQAMKGVEDCDKSGGAVKRALMPEFPNQCTLNP |
Ga0075374_100770662 | 3300030855 | Soil | MWGMSWRQEATKGVEDCEKPGGAVKRALKPGYPNRRVLNP |
Ga0075374_100911042 | 3300030855 | Soil | LGQRGQATKGVWGMPWHQEAMKGVEDCDKPGGSVKRESIPGSLNYPGVNP |
Ga0075374_101291242 | 3300030855 | Soil | VWGMSWRRQATKGVEDCDKSGGAVKRALMPEYPNRCTLNP |
Ga0102759_10277801 | 3300030858 | Soil | AGAWGMSWRQEAMKGVEDCDKPGEVVKQALIPRYPNYHALNP |
Ga0102759_19735152 | 3300030858 | Soil | ATKGVWGMSRRQEATKGVEDCDKPGGAVKRALIPGCPNYRVLNP |
Ga0102759_19760262 | 3300030858 | Soil | VWGMSWRQEAMKGVEDCEKPGGMVKRVLIPGSLNERGVNT |
Ga0102749_10021022 | 3300030867 | Soil | KGMWGMSWRQKAMKGVADCDKLGETVKRVLIPRYPNAVY |
Ga0102749_10096942 | 3300030867 | Soil | MSGRPEAMKGVEDCEKPGGAVKRALIPGFPNDRTLNP |
Ga0102749_10274532 | 3300030867 | Soil | MSWRQEAMKGVEDCDKLGGVVKQALIPRYPNYHALNP |
Ga0265776_1079772 | 3300030880 | Soil | ATKGMWGMSRRQEAMKGVEDCDKPGEAVKRALIPGSLN |
Ga0265776_1102101 | 3300030880 | Soil | TKGVWGMSWRQEATKGVEDCEKPGEAVKRALIPGYPN |
Ga0265772_1017532 | 3300030886 | Soil | MWGMSWRQQAMKGVEDCEKPGGMVKRVLIPGYPNERALNP |
Ga0308198_10994692 | 3300030904 | Soil | MWGMSWRQEAMKGVEDCEKPGGMVKRVLIPGSLNERVLNP |
Ga0075382_100418262 | 3300030917 | Soil | MSWRQKAKKGVEDCEKPGGAVKRALIPGSLNQSRLNP |
Ga0075382_100523422 | 3300030917 | Soil | MWGMSWHRQAMKGVEDCDKSGEAVKRALIPEYPNRRILNP |
Ga0075382_101065682 | 3300030917 | Soil | MWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRYPNEHVLNP |
Ga0075382_101200442 | 3300030917 | Soil | VWGMSWRQKAMKGVENCDKPGEVVKRALIPGYPNERALNP |
Ga0102762_10450262 | 3300030920 | Soil | VWRISRCQEAMKGVEDCDKPGEAVKRALIPGFLNYCILNS |
Ga0138296_17924291 | 3300030923 | Soil | GQATKGMWGMSWRQEATKGVEDCDKPGGAVKRALSPGCPNQHALNP |
Ga0138306_14423491 | 3300030936 | Soil | GQATKGVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGSLNHRGMNP |
Ga0138306_15979723 | 3300030936 | Soil | GQATKGVWGMSGRQEAMKGVEDCDNPGGAVNRALRPGSLNYRKLNP |
Ga0138303_11116001 | 3300030939 | Soil | ATKGVWGMSWRQEAMKGVEDCEKPGGAVKRALMPGCPNRRVLNP |
Ga0138303_12805552 | 3300030939 | Soil | MWGMSWRQKAMKGVEDCDKPGEVVKRTLIPGFPNMPTLNP |
Ga0138303_14093192 | 3300030939 | Soil | QATKGMWGMSWRQQAMKGVEDCDKLGGVVKRTLIPRYPNEHVLNP |
Ga0138303_14675012 | 3300030939 | Soil | MWRMSRRQEAMKGVEGCEKPGVAVKQALIPGSPNYLMLNP |
Ga0138303_14793431 | 3300030939 | Soil | QANKGVWRMSRRQEAMKGVEDCEKPGVAVKQALIPGFPNYLMLNP |
Ga0247549_1003852 | 3300030942 | Soil | VTKGVWGMSWRQKAMKGVEGCEKPGEAVKQALIPGCPNDRTLNP |
Ga0075373_116625342 | 3300030945 | Soil | MWGMSWHRQAMKGVEDCDKSGGAVKRALRPEYPNRYVLNP |
Ga0075390_100222892 | 3300030947 | Soil | VWGMSWRQEATKGAEDCDKSGGAVKRALIPEFPNYHALNP |
Ga0074034_100527252 | 3300030950 | Soil | MSRRQKAKKGVEDCEKPGGAVKRALMPGYPNRRTLNP |
Ga0074034_100536622 | 3300030950 | Soil | VWGMSWRQEAMKGVEDCDKPGEAVKRASMPGFPNWRVLNP |
Ga0102745_10299091 | 3300030960 | Soil | WRQEAMKGVEDCDKLGEVVKQALIPRYPNYHALNS |
Ga0102745_10454912 | 3300030960 | Soil | VWGMSWRQKAKKGVENCEKPGGAVKRAMSPGCPNQPPLNA |
Ga0102745_18005291 | 3300030960 | Soil | WGMSWRQKAMTGVEDCENFGVAVKQALIPKFPNQFILNP |
Ga0265768_1017872 | 3300030963 | Soil | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGFPNVAR |
Ga0075394_101528322 | 3300030969 | Soil | MWGMSRRQKAKKGVEDCDNLGGAVKRALIPRSLNQPALNP |
Ga0075381_101048982 | 3300030970 | Soil | MWGMSWRQKAMKGVEDCDKLGGVVKRTLIPRSLNEPALNP |
Ga0075381_101210382 | 3300030970 | Soil | VWGMSWRQEAMKGVEDCDKRGGAVKRALIPRSLNDPALNP |
Ga0075381_101567441 | 3300030970 | Soil | QEAKKGVEDCDKPGEAVKRALIPGYPNQQEREEEQ |
Ga0075395_100285162 | 3300030973 | Soil | MSWRQKALKGVENCDKPGVIVKQVLIPGFPNWPAPNP |
Ga0075395_100475722 | 3300030973 | Soil | MWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGSLNERVLNS |
Ga0075371_100237342 | 3300030974 | Soil | VWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNYHGVNP |
Ga0099845_10456852 | 3300030975 | Boreal Forest Soil | VWGMSRRQEAKKGVEDCDKPGGLVKRELIPGFPNHLTLNP |
Ga0102770_100275332 | 3300030981 | Soil | VWGMSRRQEAMKGVEDCEKLGVAVKRALNPRYPNEPDLNP |
Ga0102770_100281482 | 3300030981 | Soil | MWGMSWRQEAMKGVEDCEKPGGAVKRALIPGYPNDPALNP |
Ga0265748_1007402 | 3300030982 | Soil | GMPRRQKAKKGVEDCDKPGGLVKRELIPGSLNYLAVNP |
Ga0308154_1058981 | 3300030986 | Soil | KGVSGMPRRQDAMKGEEDSDNPGGAVNRALRPGCPNQPVPNP |
Ga0308178_10336352 | 3300030990 | Soil | VWGMSWRQEATKGAEDCDKPGRAVKQALTPGSPNYPALNP |
Ga0073997_101062982 | 3300030997 | Soil | VWGMSWRQKAMKGVEGCEKPGEAVKRALIPGYPNDRTLNP |
Ga0265774_1035751 | 3300031011 | Soil | KGMWGMSWRQEAKKGVEDCDKPGGAVKQALIPGCPNERALNS |
Ga0102753_10196582 | 3300031013 | Soil | VWGMSWRWKAMKGVEDCDKPGGSVKRELIPGYPNYRALNP |
Ga0138298_13731531 | 3300031015 | Soil | ATKGVWGMPWHQEAMKGVEDCDKPGGSVKRELIPGSLNYPLANP |
Ga0138298_17345062 | 3300031015 | Soil | MWGMSRRQKAKKGVEDCDKPGGAVKRALIPGYPNWRTLNP |
Ga0265732_1038681 | 3300031016 | Soil | ATKGVWGMSWRQEAMKGVEDCEKPGGAVKRALIPGSLNDTH |
Ga0265773_10100452 | 3300031018 | Soil | VWGMSWRQEAMKGVEDCEKPGGAVKRALRPGYPNWQALNP |
Ga0102765_101410372 | 3300031021 | Soil | VWGMSWHQKAKKGVEDCEKPGGAVKRALNPGYPNQPALNA |
Ga0138301_11305232 | 3300031022 | Soil | VWGMPWRQEAMKGVEDCDKPGEAVKRALIPGSLNWRTLNP |
Ga0138301_11698842 | 3300031022 | Soil | VWGMSWRQEATKGAEDCDKLGGAVKRALIPRFPNHHALNP |
Ga0138301_16469171 | 3300031022 | Soil | QCGQATKGVWGMSGRQEAMKGVEDCDNPGGAVNQALRPGSLN |
Ga0073998_100866812 | 3300031023 | Soil | MSWRQEAMKGVENCDKPGGMVKRVLIPGFPNWPGLNP |
Ga0102760_100070672 | 3300031039 | Soil | GMSWRQEALKGVEDCEKLGGIVKRVLIPRFPNRHALNS |
Ga0265755_1081541 | 3300031041 | Soil | KGMWGMSRRQEAMKGVEDCYKPGGAVKRALIPGSLN |
Ga0265749_1040861 | 3300031042 | Soil | KGVWGMPWRQEAMKRVEDCDKPGELVKRELIPGFPNYLGVNP |
Ga0073995_100586132 | 3300031047 | Soil | VWGMPRRQKAMKGVEDCDKPGGLVKRELIPGSLNYL |
Ga0073995_100798652 | 3300031047 | Soil | VWGMSRRQKAKKGVEDCEKPGGAVKRALRPGYPNERVLNP |
Ga0074018_17880772 | 3300031053 | Soil | MWGMSWRQEAMKGVEDCDKPGGAVKRALRPGFPNQRTLNP |
Ga0102746_100362102 | 3300031054 | Soil | MSWRQEALKGVEDCEKLGVVVKRTLIPRFPNCHTLNP |
Ga0102746_100382882 | 3300031054 | Soil | VWGMPWRQEAMKGVEDCDKPGGTVKRVLIPGYPNYSRANP |
Ga0102746_100696722 | 3300031054 | Soil | VWGMSWRQEATKGVEDCDKLGGAVKRALIPRSLNYPGLNP |
Ga0102746_100727792 | 3300031054 | Soil | VWGMPWRQKAMKGVEDCDKPGGLVKRELIPGSLNQLRVNP |
Ga0102746_100886322 | 3300031054 | Soil | VWGMSRRQEAMKGVEDCDKPGGAVKRALMPGCPNWPALNA |
Ga0102751_13950222 | 3300031055 | Soil | KGVWGMSRRQEAMKGVEGCEKPGGAVKRALRPGSLNQRTLNP |
Ga0170834_1037796422 | 3300031057 | Forest Soil | VWRMPWHQEAMKGVEDCDKPGGSVKRELIPGSLNDSRVNP |
Ga0170834_1082607923 | 3300031057 | Forest Soil | TKGMWGMSWRQEAMKGVEDCDKPGEMVKRVLIPGYPNQRMLNP |
Ga0308192_10326581 | 3300031082 | Soil | GVWGMSRRQEAMKGAAGCDKPGGAVNEALRPGFPNYRVLNP |
Ga0102748_100634112 | 3300031089 | Soil | VWGMSGRQEAMKGVEDCDNLGGAVNRALRPRSLNNCTLNP |
Ga0102748_101037752 | 3300031089 | Soil | SWRQEATKGVEDCDKLGEVVKQALIPRYPNYHALNP |
Ga0308201_102594252 | 3300031091 | Soil | VWGMSWRQKAKGQDCDKSGGAVKRALIPECPSEPRELKHL |
Ga0308199_11091531 | 3300031094 | Soil | ATKGVWGMPWRQKAMKGVEDCEKPGGLVKRELIPGSLN |
Ga0308193_10630882 | 3300031096 | Soil | VWGMSWRQEAKKGVQDCDKPGEVVKRALIPGYPNERALNP |
Ga0308188_10268932 | 3300031097 | Soil | MPWCQEAMKGVENCDKLGEAVKQALIPRFPNDRALNT |
Ga0308187_101639202 | 3300031114 | Soil | KGVWGMSGRQQAKKGVQDCEKPGGAVNQALRPGCPN |
Ga0170822_103896663 | 3300031122 | Forest Soil | GQATKGMWGMSRRQEAKKGVEDCDKPGEAVKRALRPGFPNSRALNP |
Ga0170822_134282003 | 3300031122 | Forest Soil | WGMSWRQEAMKGVEDCDKPGEMVKRVLIPGYPNQRMLNP |
Ga0308195_10461492 | 3300031123 | Soil | VWGMPWHQEAMKGVEDCDKLGGLVKRELIPRFPNDPGVNP |
Ga0308151_10253552 | 3300031124 | Soil | MWGMSWRWKAMKCVEDCEKLVEAVNQELIPRSLNAAY |
Ga0308182_10073952 | 3300031125 | Soil | VWGMPWRQEAMKGVEVCDKPGGLVKRELIPGSLNYSGVNP |
Ga0170824_1008724202 | 3300031231 | Forest Soil | VWRMPWHQEAMKGVEDCDKPGGSVKRELIPGSLNDPLVNP |
Ga0170824_1017072052 | 3300031231 | Forest Soil | VWGMSWRQEAKKGVEDCDKPGGAVKQALIPGSLNRRVLNP |
Ga0170824_1027532732 | 3300031231 | Forest Soil | MWGMSWRQEAKKGVEDCEKPGGAVKRASIPGYPNERDLNT |
Ga0170824_1148768952 | 3300031231 | Forest Soil | VWGMSWRQKAKKGVEGCEKPGEAVKQALIPGFPNVVR |
Ga0170824_1257179032 | 3300031231 | Forest Soil | WGMSWRQEAKKGVEDCEKPGGAVKRALRPGFPNGPVLNP |
Ga0308179_10034311 | 3300031424 | Soil | KGVWGMSWRQEAKKGVEDCEKPGGAVKRALRPGFPNGPVLNP |
Ga0308179_10157261 | 3300031424 | Soil | AHKGVWGMSWHQKAMKGVEGCDKPGEAVKRALIPGFPNDRTLNT |
Ga0170820_131140622 | 3300031446 | Forest Soil | VWGMSWRQEAMKGVENCDKPGGAVKRALIPGSLNAAV |
Ga0170820_133326262 | 3300031446 | Forest Soil | VWGMSRRQEAKKGVEDCEKSGGAVKRASIPECPNERVLNP |
Ga0170820_149959912 | 3300031446 | Forest Soil | MSWLQEALKGVEDCDKLGVFVKRKLIPRFPNRPLMNT |
Ga0170820_165000962 | 3300031446 | Forest Soil | VWGMPWRQEATKGVEDCDKPGEAVKRALIPGSLNWRVLNP |
Ga0170820_166003552 | 3300031446 | Forest Soil | MWGMSWRQEAMKGVEDCDKPGGVVKRTLIPGYPNEP |
Ga0170819_103186322 | 3300031469 | Forest Soil | MSWRQKAMKGVEDCDKPGGMVKRVLIPGSLNYHSLNP |
Ga0170819_161549742 | 3300031469 | Forest Soil | MSWRQEASKGVEDCDKPGVIVKRVLIPGFPNQHALNQ |
Ga0170819_175735722 | 3300031469 | Forest Soil | VWRMSRRQEAMKGVEGCDMPGVAVKQAMIPGFPNYHALNP |
Ga0170819_179847622 | 3300031469 | Forest Soil | MWGMSWRQKAMKGVEDCDKLGGVVKRTLIPRSLNWPALNP |
Ga0170818_1034812891 | 3300031474 | Forest Soil | GMSWRQEALKGVEDCENLGGTVKRVLIPRYPNWQALNS |
Ga0170818_1035887792 | 3300031474 | Forest Soil | VWGMSWRQEATKGVEDCDKPGGAVKRALIPGSLNYRALNP |
Ga0170818_1056921372 | 3300031474 | Forest Soil | VWGMSGRQEAMKGVEDCDKPGETVKRVLIPGFPNECALNS |
Ga0170818_1062909222 | 3300031474 | Forest Soil | VWGMSWRQKAMKGVEGCEKPGEAVKQALIPGFPNDRTLNP |
Ga0170818_1065835172 | 3300031474 | Forest Soil | GQANKGVWRMSRRQEAMKGVEGCEKPGVAVKQAMIPGFLNYLMLNP |
Ga0314822_1108692 | 3300031484 | Soil | MSWRQKAMKGVEDCEKLGGTVKQVMIPGFPNQRILNS |
Ga0314818_1114141 | 3300031499 | Soil | GARGMSWHQQAMKGVEGCDKPWGAVKQALIPGYPNQCILNP |
Ga0310915_103780252 | 3300031573 | Soil | VWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGFPNERMLNP |
Ga0310915_107064353 | 3300031573 | Soil | VWRMSWRQKAMKGVEGCEKPGEAVKQALIPGFPNDRAPNP |
Ga0306925_107883592 | 3300031890 | Soil | MWGMSWRQEARKGAAGCDKPGGVVKRALIPGFPNHRTLNP |
Ga0316039_1175131 | 3300031891 | Soil | TKGVWGMSRRQEAMKGAAGCDKPGGAVNEALRPGFPNYRVLNP |
Ga0306923_111435852 | 3300031910 | Soil | MWGMSWRRQAMKGVEDCDKSGEAVKRALMPEFPNQCTLNP |
Ga0306923_117783862 | 3300031910 | Soil | VWGMPWHQEATKGVEDCDKPGGLVKRELIPGSLNQRAVNP |
Ga0306921_109673462 | 3300031912 | Soil | MWGMSWRQEAMKGVEDCDKPGGAVKRALRPGSPNRPALNP |
Ga0306926_113424892 | 3300031954 | Soil | MWGMSWRQKAMKGVEDCDKLGEAVKRALIPRFPNRCMLNP |
Ga0316035_1103492 | 3300031955 | Soil | GMWGMSWRQQAKKGVEDCEKPGEAVKRALIPGSLNQQRLNP |
Ga0316032_1064991 | 3300031956 | Soil | GVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNYHGVNPIAP |
Ga0326597_109112632 | 3300031965 | Soil | MSWCQEAMKGVEDCDKPGEAVKRALIPGSLNERSLNS |
Ga0306922_119013282 | 3300032001 | Soil | VWGMSWRQEARKGVEDCDKPGGAVKRALRPGSPNHRALNP |
Ga0247536_1030492 | 3300032027 | Soil | KGVWGMSGRQEATKGVEDCDNLGGAVNRALRPRSLNNHALNP |
Ga0310911_108432952 | 3300032035 | Soil | VWGMSWRQEAMKGVEDCDKPGGMVKRVLIPGCPNERMLNP |
Ga0318532_101821472 | 3300032051 | Soil | VWGMSWRQEATKGAEDCDKSGGAVKRALIPGFPNHHALNP |
Ga0318533_106344042 | 3300032059 | Soil | VWRMSWRQKAMKGVEGCEKLGGAVKQALIPGFPNDRAPNP |
Ga0318533_106978872 | 3300032059 | Soil | VWGMSWRQKAMKGVEDCDKPGGAVKRVLIPGSLNERVLNP |
Ga0316053_1030951 | 3300032120 | Soil | ATKGVWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNHPRLNP |
Ga0311301_108298752 | 3300032160 | Peatlands Soil | MWGMSWRQKARKGVEDCDKPGEAVKQALLPGFPNQPALNP |
Ga0307471_1011093722 | 3300032180 | Hardwood Forest Soil | VWGMPWRQEAMKGVEDCDKPGGLVKRELIPGSLNQPHVNPIA |
Ga0306920_1001756211 | 3300032261 | Soil | MPRRQKAMKGVEDCDKLGGLVKRELIPRSLNQHGVNP |
Ga0306920_1016794322 | 3300032261 | Soil | MWGMSWRQEAMKGVEDCEKPGGMVKRVLIPGFPNRRTLNS |
Ga0306920_1018118502 | 3300032261 | Soil | MWGMSWRQKAMKGVEDCEKPGVAVNRALIPGFPNYRALNP |
Ga0306920_1020753102 | 3300032261 | Soil | VWGMSWRQEATKGVEDCDKPGGIVKRVLIPGFPNQRPLNP |
Ga0348332_101337743 | 3300032515 | Plant Litter | WRQKAKKGVEDCEKPGGAVNRALRPGYPNERTLNP |
Ga0348332_106224491 | 3300032515 | Plant Litter | VTKGVWGMSRRQEAMKGVEDCDKPGGLVKRELIPGFPNDRTLNS |
Ga0348332_107509922 | 3300032515 | Plant Litter | GMSRRQEAMKGVEDCDKPGGLVKRDLIPGYPNDPALNS |
Ga0348332_135206311 | 3300032515 | Plant Litter | ATKGMWGMSWRQKAKKGVENCDKPGEVVKRASIPGFPN |
Ga0348332_141359201 | 3300032515 | Plant Litter | TKGVWGMSWRQEAMKGAENCDKSGGAVKRALIPEFPNHHALNP |
Ga0315742_130395382 | 3300032756 | Forest Soil | MWGMSRRQEAKKGVEDCEKPGGAVKQALMPGYPNWSALNP |
Ga0335075_115898892 | 3300032896 | Soil | VWGMSWRQEAMKGVEDCDNPGGAVNRALRPGSLNYCTLNP |
Ga0314801_185118_2_154 | 3300034676 | Soil | ATKGVWGMPWRQEAKKGAEDCDKPGGLVKRELIPGHQRTNRLWHLADGLA |
⦗Top⦘ |