Sample 3300008578

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008578

3300008578: Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Powermax_1a

Overview

Basic Information
IMG/M Taxon OID	3300008578 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117956 \| Gp0126238 \| Ga0103649
Sample Name	Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Powermax_1a
Sequencing Status	Permanent Draft
Sequencing Center	Auburn University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	7133552
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → rhizosphere → soil
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere

Location Information
Location	Ohio, USA
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001679	Metagenome / Metatranscriptome	653	Y
F046210	Metagenome / Metatranscriptome	151	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0103649_100182	Not Available	703	Open in IMG/M
Ga0103649_100232	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	664	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103649_100182	Ga0103649_1001821	F046210	SSGINAEKGFRRTLFEPELVDPNLEINFVNDAEAALKSCNVNS*
Ga0103649_100232	Ga0103649_1002322	F001679	MWGMSRRQVAMKGVEGCDKPGGAVKRALIPGSLNYHGLNT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.