x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300006227
3300006227: Marine sediment microbial communities, 10.1 km from oil contamination, ambient, Gulf of Mexico ? BC101
Overview
Basic Information |
IMG/M Taxon OID | 3300006227 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116840 | Gp0121719 | Ga0082386 |
Sample Name | Marine sediment microbial communities, 10.1 km from oil contamination, ambient, Gulf of Mexico ? BC101 |
Sequencing Status | Permanent Draft |
Sequencing Center | Yale Center for Genome Analysis |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 38890870 |
Sequencing Scaffolds | 6 |
Novel Protein Genes | 6 |
Associated Families | 4 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
Not Available | 6 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico |
Location Information |
Location | Gulf of Mexico |
Coordinates | Lat. (o) | 28.3 | Long. (o) | -88.2 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F030135 | Metagenome / Metatranscriptome | 186 | Y |
F047147 | Metagenome / Metatranscriptome | 150 | Y |
F060086 | Metagenome / Metatranscriptome | 133 | Y |
F082867 | Metagenome / Metatranscriptome | 113 | Y |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0082386_105279 | Ga0082386_1052791 | F060086 | DSNLLLSSGRNCEDRKRQYINLYDHETPLLYDLADLLY* |
Ga0082386_105293 | Ga0082386_1052931 | F047147 | TIIVAVTEGPVREEQLLHDMCLLGAMTVEITQILTRAR* |
Ga0082386_105342 | Ga0082386_1053421 | F060086 | GQEDPFELDSNLLLSSGRHGRDRKRQYFLYDNETPLLGDLADLLY* |
Ga0082386_121574 | Ga0082386_1215741 | F082867 | KSMTGGRKKGSRSRRVHHINDINHNDTNITVQYRVVKPLTFSSNTLVLSVNPSLTDLSTTLATIYRQYRVTELSFTFQCSDAAGAYALAMQYVPQIGGTPSTLPTTLAEFEGPAVGYCETGRGREYTYRVPSHVLNAMGLNYYATRTGVTPIQDPDILTQGLMIFLTSTPATPIVAYMHVKFEFQTLEDPSFLAKLMHDDKEADTLVVPRAKADSLKSMTWNQL* |
Ga0082386_122586 | Ga0082386_1225861 | F030135 | DREELATLSSFTDIWHSTFAGCQFPDAILPGTEAIDLVAGPLS* |
Ga0082386_125924 | Ga0082386_1259241 | F030135 | ATLSSITDIGHSAYAGRQFPDAILPGREAVDLVAGPLN* |