Sample 3300006967

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300006967

3300006967: T0 (1) T34 (live) enrichments of Methanogenic microbial communities using Athabascan oil sands

Overview

Basic Information
IMG/M Taxon OID	3300006967 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117890 \| Gp0125713 \| Ga0102599
Sample Name	T0 (1) T34 (live) enrichments of Methanogenic microbial communities using Athabascan oil sands
Sequencing Status	Permanent Draft
Sequencing Center	Shell Corporation
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	25648119
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada
Type	Environmental
Taxonomy	Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → oil reservoir → sand
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Canada: Alberta
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.65	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088355	Metagenome / Metatranscriptome	109	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0102599_111308	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	508	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0102599_111308	Ga0102599_1113081	F088355	LNKSLSTLGEKIMKNIKNKISVFAGQKGQLVLAILTIALFVLAAGAPNATIGVGR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.