Basic Information | |
---|---|
IMG/M Taxon OID | 3300013900 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118643 | Gp0137859 | Ga0117820 |
Sample Name | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 250 |
Sequencing Status | Permanent Draft |
Sequencing Center | Chalmers University of Technology |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 66675936 |
Sequencing Scaffolds | 7 |
Novel Protein Genes | 7 |
Associated Families | 7 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | ||||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029444 | Metagenome | 188 | Y |
F047125 | Metagenome / Metatranscriptome | 150 | N |
F051935 | Metagenome | 143 | N |
F056309 | Metagenome | 137 | N |
F062845 | Metagenome | 130 | N |
F082887 | Metagenome / Metatranscriptome | 113 | Y |
F090513 | Metagenome | 108 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0117820_1000015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 62494 | Open in IMG/M |
Ga0117820_1000482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 5338 | Open in IMG/M |
Ga0117820_1002236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2179 | Open in IMG/M |
Ga0117820_1016546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 749 | Open in IMG/M |
Ga0117820_1017238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 732 | Open in IMG/M |
Ga0117820_1018584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 703 | Open in IMG/M |
Ga0117820_1025894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 586 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0117820_1000015 | Ga0117820_10000153 | F082887 | MEKIKAIAKYAINILAIISALIAGINAVDGITIPYAVQIIQVIAVIQGVISTYLLGQKVVRNRGENRENNRNKPKV* |
Ga0117820_1000482 | Ga0117820_10004823 | F029444 | MGVSEQLTGFEPEDLMSWTVSNLQRPFREDFSLEISGIIAEKESQIFGRRFVGFDGPKKAAPFFNF* |
Ga0117820_1002236 | Ga0117820_10022362 | F051935 | MKEEKRMKRLLGLLMAVMVMMGGISCAVAENTNPIVSDWLTELKSKRLIQIVEDEIGEGWTLYQPNGREEEENFSSAANLKEMRFLPVVAQKDNQLRLLILRRQGDLWKVSEQNDRALMRDGWTLQNFSAMPYGNSDWTYIYFDFVDENQKRWNLMLNLGDGYVSSFGTISHYVEGYGTTYINMNYDRGLEFLIDAPAYSRFSYEVYPVERYSFGVEDFDLATCPLTMQEFLVPAIVTCGEEGAGLYIMVQQDVQPIVTLADGDAIEAIPQKWELDWTIVYYQGNYLFMKTENCKMEE* |
Ga0117820_1016546 | Ga0117820_10165461 | F090513 | MLKIFEIAKYVRKMEWKLLHIKHILYMRPFGALKIVPQSVGNKNGTKAVLQGWAAAFV |
Ga0117820_1017238 | Ga0117820_10172381 | F047125 | LLMVLGVMLSGFRTADALDHIRREILRQEGKRRGWWS* |
Ga0117820_1018584 | Ga0117820_10185841 | F062845 | FILHEKFRSDNNEQRKEQFQKRFERYIVDELSNIAPSKSCA* |
Ga0117820_1025894 | Ga0117820_10258941 | F056309 | MPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD*EAASPV |
⦗Top⦘ |