NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017644

3300017644: Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C Kraft BY (version 2)



Overview

Basic Information
IMG/M Taxon OID3300017644 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0127392 | Gp0191740 | Ga0182740
Sample NameEnriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C Kraft BY (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size355932473
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3
All Organisms → cellular organisms → Bacteria → Proteobacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017885Metagenome / Metatranscriptome238Y
F020046Metagenome / Metatranscriptome226Y
F034415Metagenome / Metatranscriptome175Y
F038627Metagenome / Metatranscriptome165Y
F046477Metagenome / Metatranscriptome151Y
F053349Metagenome141Y
F064527Metagenome / Metatranscriptome128Y
F104871Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0182740_1000001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1363100Open in IMG/M
Ga0182740_1000023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales386616Open in IMG/M
Ga0182740_1002963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales9958Open in IMG/M
Ga0182740_1008634All Organisms → cellular organisms → Bacteria → Proteobacteria4732Open in IMG/M
Ga0182740_1035775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1591Open in IMG/M
Ga0182740_1050837All Organisms → cellular organisms → Bacteria1210Open in IMG/M
Ga0182740_1060302All Organisms → cellular organisms → Bacteria → Proteobacteria1057Open in IMG/M
Ga0182740_1127114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum586Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0182740_1000001Ga0182740_1000001953F034415MSAAATHTGHKRLQHLVEHEAYRRIMAGEAPETLSEFARELQGWLQRNYPDAAPTTPDAIENQIRETWHRRHELIRGG
Ga0182740_1000023Ga0182740_100002323F017885MSSTDMNEICFQCPSCGHDLKQSIGRLKQSQHMTCPGCGIGINIDTNRLAQVSEEIQKAIDKVPPEITIKFYRPIEQD
Ga0182740_1002963Ga0182740_100296310F104871MPDREAHLRTLAERLMFSVEQTGDRFTLTRTADVSRPVREAGLTIDQAEELLETWKLRGPHGG
Ga0182740_1008634Ga0182740_10086343F038627MIRFALVLAFAIGLYPARALPQTSQFKGWAAISQELSTRIAPAGEPLDLGEFLPADDMEDLLGTWSTFGTEHTFRNGVPNALNLMIWQVTLSGFANAVGESCEKDRLVFHPRFDAVLHKLCAWPAPAAKDEAVLLDFWLGIMGHNAGEDEYIAWREFFLTQYRDRKPAETIAAMTLAITMNPRFLLHR
Ga0182740_1035775Ga0182740_10357751F053349MKNYEDGAYAMAALSASLVAFRLLLSKGLVSRDEAVRALLDEAVSRAIFAEAKLQDRTISEATAEMNRQSAEILKMFADGL
Ga0182740_1050837Ga0182740_10508372F020046MLCCGHMTGPTDRPMRPELRLRDGHVVRSLADAIAVLREHEGRPGVDIRDEVLHRLERAQTEDERREATQAFLVWAKELELLSPGDIAKFRAG
Ga0182740_1060302Ga0182740_10603023F046477MQVRDEQSVTPGVNKVAGRPHALAQRIAAFLRKRNAGYCETCLIARLLVASRAAMRAALEMDCFSVRVGVCPDCKTRKQVITCKAGSNVAA
Ga0182740_1127114Ga0182740_11271142F064527ADRVRTLLLRADNVLKNEGDPEDRARRARAALEEARAVAAGGGVDPRVAELIERRLAALEAGGPG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.