NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027191

Metagenome / Metatranscriptome Family F027191

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027191
Family Type Metagenome / Metatranscriptome
Number of Sequences 195
Average Sequence Length 83 residues
Representative Sequence EKPLLQSINLVKVVRFLISPKKKRAKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Number of Associated Samples 180
Number of Associated Scaffolds 195

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 21.13 %
% of genes near scaffold ends (potentially truncated) 56.41 %
% of genes from short scaffolds (< 2000 bps) 99.49 %
Associated GOLD sequencing projects 177
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.410 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(36.410 % of family members)
Environment Ontology (ENVO) Unclassified
(58.462 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(71.795 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.70%    β-sheet: 0.00%    Coil/Unstructured: 46.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 195 Family Scaffolds
PF00033Cytochrome_B 7.69
PF00115COX1 1.54
PF13631Cytochrom_B_N_2 1.03
PF01248Ribosomal_L7Ae 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 195 Family Scaffolds
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 7.69
COG1358Ribosomal protein L7Ae or related RNA K-turn-binding proteinTranslation, ribosomal structure and biogenesis [J] 0.51
COG1911Ribosomal protein L30ETranslation, ribosomal structure and biogenesis [J] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.46 %
UnclassifiedrootN/A1.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001282|B570J14230_10214881All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300002370|B570J29631_103656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae781Open in IMG/M
3300004793|Ga0007760_10203186All Organisms → cellular organisms → Eukaryota → Sar1053Open in IMG/M
3300005433|Ga0066830_10099114All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Francisellaceae → Francisella → Francisella persica618Open in IMG/M
3300005805|Ga0079957_1189983All Organisms → cellular organisms → Bacteria → Proteobacteria1001Open in IMG/M
3300006357|Ga0075502_1091909All Organisms → cellular organisms → Eukaryota → Sar778Open in IMG/M
3300006384|Ga0075516_1023559All Organisms → cellular organisms → Eukaryota → Sar603Open in IMG/M
3300006401|Ga0075506_1098729All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Francisellaceae → Francisella → Francisella persica557Open in IMG/M
3300006571|Ga0075505_1043303All Organisms → cellular organisms → Eukaryota → Sar542Open in IMG/M
3300007162|Ga0079300_10164286All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Francisellaceae → Francisella → Francisella persica595Open in IMG/M
3300007513|Ga0105019_1130233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1329Open in IMG/M
3300007558|Ga0102822_1178450All Organisms → cellular organisms → Eukaryota → Sar505Open in IMG/M
3300007725|Ga0102951_1236855All Organisms → cellular organisms → Eukaryota → Sar519Open in IMG/M
3300008113|Ga0114346_1122709All Organisms → cellular organisms → Eukaryota → Sar1154Open in IMG/M
3300008624|Ga0115652_1115860All Organisms → cellular organisms → Eukaryota → Sar809Open in IMG/M
3300008764|Ga0103913_100337All Organisms → cellular organisms → Eukaryota → Sar793Open in IMG/M
3300008795|Ga0103701_102439All Organisms → cellular organisms → Eukaryota → Sar569Open in IMG/M
3300008799|Ga0103766_1025207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae507Open in IMG/M
3300008800|Ga0103767_1020918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae521Open in IMG/M
3300008832|Ga0103951_10173273All Organisms → cellular organisms → Eukaryota → Sar1023Open in IMG/M
3300008835|Ga0103883_1044710All Organisms → cellular organisms → Eukaryota → Sar584Open in IMG/M
3300008856|Ga0103902_100262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae831Open in IMG/M
3300008930|Ga0103733_1003599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1857Open in IMG/M
3300008958|Ga0104259_1004923All Organisms → cellular organisms → Eukaryota → Sar1113Open in IMG/M
3300008998|Ga0103502_10229449All Organisms → cellular organisms → Eukaryota → Sar681Open in IMG/M
3300008999|Ga0102816_1277403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae531Open in IMG/M
3300009081|Ga0105098_10690855All Organisms → cellular organisms → Eukaryota → Sar541Open in IMG/M
3300009152|Ga0114980_10120698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1562Open in IMG/M
3300009159|Ga0114978_10569865All Organisms → cellular organisms → Eukaryota → Sar657Open in IMG/M
3300009163|Ga0114970_10422171All Organisms → cellular organisms → Eukaryota → Sar738Open in IMG/M
3300009216|Ga0103842_1031234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae598Open in IMG/M
3300009216|Ga0103842_1032534All Organisms → cellular organisms → Eukaryota → Sar591Open in IMG/M
3300009225|Ga0103851_1039941All Organisms → cellular organisms → Eukaryota → Sar767Open in IMG/M
3300009235|Ga0103857_10036461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae904Open in IMG/M
3300009268|Ga0103874_1000620All Organisms → cellular organisms → Eukaryota → Sar1225Open in IMG/M
3300009274|Ga0103878_1001587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1314Open in IMG/M
3300009327|Ga0103843_102514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales910Open in IMG/M
3300009340|Ga0103838_1000961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1064Open in IMG/M
3300009344|Ga0103834_1004532All Organisms → cellular organisms → Eukaryota → Sar697Open in IMG/M
3300009357|Ga0103827_1009539All Organisms → cellular organisms → Eukaryota → Sar591Open in IMG/M
3300009390|Ga0103831_1021296All Organisms → cellular organisms → Eukaryota → Sar533Open in IMG/M
3300009402|Ga0103742_1010546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1061Open in IMG/M
3300009420|Ga0114994_10638798All Organisms → cellular organisms → Eukaryota → Sar697Open in IMG/M
3300009432|Ga0115005_10270683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1333Open in IMG/M
3300009436|Ga0115008_11090861All Organisms → cellular organisms → Eukaryota → Sar600Open in IMG/M
3300009441|Ga0115007_10752237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae657Open in IMG/M
3300009516|Ga0129359_1024796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae502Open in IMG/M
3300009526|Ga0115004_10664436All Organisms → cellular organisms → Eukaryota → Sar618Open in IMG/M
3300009544|Ga0115006_10486459All Organisms → cellular organisms → Eukaryota → Sar1081Open in IMG/M
3300009550|Ga0115013_11462457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae510Open in IMG/M
3300009592|Ga0115101_1144300All Organisms → cellular organisms → Eukaryota → Sar587Open in IMG/M
3300009593|Ga0115011_11130823All Organisms → cellular organisms → Eukaryota → Sar671Open in IMG/M
3300009717|Ga0123375_10034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae804Open in IMG/M
3300009741|Ga0123361_1018693All Organisms → cellular organisms → Eukaryota → Sar770Open in IMG/M
3300009748|Ga0123370_1106971All Organisms → cellular organisms → Eukaryota → Sar620Open in IMG/M
3300009748|Ga0123370_1127807All Organisms → cellular organisms → Eukaryota → Sar562Open in IMG/M
3300009750|Ga0123368_1098391All Organisms → cellular organisms → Eukaryota → Sar643Open in IMG/M
3300009753|Ga0123360_1079999All Organisms → cellular organisms → Eukaryota → Sar701Open in IMG/M
3300009754|Ga0123364_1132382All Organisms → cellular organisms → Eukaryota → Sar683Open in IMG/M
3300010034|Ga0126342_10202155All Organisms → cellular organisms → Eukaryota → Sar1082Open in IMG/M
3300010129|Ga0123376_1149437All Organisms → cellular organisms → Eukaryota → Sar638Open in IMG/M
3300011012|Ga0150979_1066925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae960Open in IMG/M
3300012419|Ga0138260_10927271All Organisms → cellular organisms → Eukaryota → Sar563Open in IMG/M
3300012525|Ga0129353_1741791All Organisms → cellular organisms → Eukaryota → Sar525Open in IMG/M
3300012705|Ga0157555_1072830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae754Open in IMG/M
3300012710|Ga0157550_1229732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae868Open in IMG/M
3300012711|Ga0157607_1163993All Organisms → cellular organisms → Eukaryota → Sar559Open in IMG/M
3300012712|Ga0157598_1002725All Organisms → cellular organisms → Eukaryota → Sar708Open in IMG/M
3300012720|Ga0157613_1162153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae597Open in IMG/M
3300012748|Ga0157553_1047950All Organisms → cellular organisms → Eukaryota → Sar724Open in IMG/M
3300012754|Ga0138278_1151883All Organisms → cellular organisms → Eukaryota → Sar627Open in IMG/M
3300012756|Ga0138272_1103946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae729Open in IMG/M
3300012763|Ga0138289_1141095All Organisms → cellular organisms → Eukaryota → Sar647Open in IMG/M
3300012767|Ga0138267_1039879All Organisms → cellular organisms → Eukaryota → Sar520Open in IMG/M
3300012919|Ga0160422_10373983All Organisms → cellular organisms → Eukaryota → Sar885Open in IMG/M
3300012967|Ga0129343_1209930All Organisms → cellular organisms → Eukaryota → Sar576Open in IMG/M
3300013093|Ga0164296_1139735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae975Open in IMG/M
3300013295|Ga0170791_13965899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae987Open in IMG/M
3300016697|Ga0180057_1156270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae820Open in IMG/M
3300016923|Ga0186368_106947All Organisms → cellular organisms → Eukaryota → Sar559Open in IMG/M
3300017329|Ga0186525_1022017All Organisms → cellular organisms → Eukaryota → Sar782Open in IMG/M
3300017486|Ga0186434_1043132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales677Open in IMG/M
3300018521|Ga0193171_107127All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300018521|Ga0193171_107128All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300018543|Ga0188820_101419All Organisms → cellular organisms → Eukaryota → Sar502Open in IMG/M
3300018550|Ga0188833_100865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae709Open in IMG/M
3300018597|Ga0193035_1023001All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300018602|Ga0193182_1006581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae938Open in IMG/M
3300018604|Ga0193447_1022582All Organisms → cellular organisms → Eukaryota → Sar570Open in IMG/M
3300018621|Ga0193093_1028488All Organisms → cellular organisms → Eukaryota → Sar672Open in IMG/M
3300018636|Ga0193377_1011394All Organisms → cellular organisms → Eukaryota → Sar735Open in IMG/M
3300018660|Ga0193130_1055428All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300018668|Ga0193013_1060412All Organisms → cellular organisms → Eukaryota → Sar509Open in IMG/M
3300018690|Ga0192917_1071080All Organisms → cellular organisms → Eukaryota → Sar503Open in IMG/M
3300018696|Ga0193110_1006233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1036Open in IMG/M
3300018709|Ga0193209_1061656All Organisms → cellular organisms → Eukaryota → Sar525Open in IMG/M
3300018714|Ga0193349_1061708All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300018747|Ga0193147_1082870All Organisms → cellular organisms → Eukaryota → Sar525Open in IMG/M
3300018764|Ga0192924_1050838All Organisms → cellular organisms → Eukaryota → Sar513Open in IMG/M
3300018769|Ga0193478_1053219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae653Open in IMG/M
3300018769|Ga0193478_1064596All Organisms → cellular organisms → Eukaryota → Sar586Open in IMG/M
3300018783|Ga0193197_1021011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae973Open in IMG/M
3300018794|Ga0193357_1088993All Organisms → cellular organisms → Eukaryota → Sar503Open in IMG/M
3300018814|Ga0193075_1090845All Organisms → cellular organisms → Eukaryota → Sar529Open in IMG/M
3300018845|Ga0193042_1096444All Organisms → cellular organisms → Eukaryota → Sar788Open in IMG/M
3300018845|Ga0193042_1106517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae723Open in IMG/M
3300018852|Ga0193284_1082631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae509Open in IMG/M
3300018860|Ga0193192_1049606All Organisms → cellular organisms → Eukaryota → Sar564Open in IMG/M
3300018903|Ga0193244_1014488All Organisms → cellular organisms → Eukaryota → Sar1315Open in IMG/M
3300018942|Ga0193426_10020419All Organisms → cellular organisms → Eukaryota → Sar1248Open in IMG/M
3300018947|Ga0193066_10088651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae894Open in IMG/M
3300018961|Ga0193531_10105648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1107Open in IMG/M
3300018961|Ga0193531_10143844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae930Open in IMG/M
3300018966|Ga0193293_10108718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae546Open in IMG/M
3300018967|Ga0193178_10069230All Organisms → cellular organisms → Eukaryota → Sar549Open in IMG/M
3300018967|Ga0193178_10083708All Organisms → cellular organisms → Eukaryota → Sar507Open in IMG/M
3300018968|Ga0192894_10240748All Organisms → cellular organisms → Eukaryota → Sar604Open in IMG/M
3300018969|Ga0193143_10166061All Organisms → cellular organisms → Eukaryota → Sar648Open in IMG/M
3300018976|Ga0193254_10041430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1047Open in IMG/M
3300018977|Ga0193353_10194897All Organisms → cellular organisms → Eukaryota → Sar593Open in IMG/M
3300018977|Ga0193353_10214894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae557Open in IMG/M
3300018977|Ga0193353_10243094All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300018981|Ga0192968_10128616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae664Open in IMG/M
3300018981|Ga0192968_10184314All Organisms → cellular organisms → Eukaryota → Sar528Open in IMG/M
3300018985|Ga0193136_10253440All Organisms → cellular organisms → Eukaryota → Sar522Open in IMG/M
3300018985|Ga0193136_10261321All Organisms → cellular organisms → Eukaryota → Sar513Open in IMG/M
3300018986|Ga0193554_10319497All Organisms → cellular organisms → Eukaryota → Sar587Open in IMG/M
3300018986|Ga0193554_10319503All Organisms → cellular organisms → Eukaryota → Sar587Open in IMG/M
3300019007|Ga0193196_10157532All Organisms → cellular organisms → Eukaryota → Sar964Open in IMG/M
3300019017|Ga0193569_10371011All Organisms → cellular organisms → Eukaryota → Sar563Open in IMG/M
3300019017|Ga0193569_10418348All Organisms → cellular organisms → Eukaryota → Sar511Open in IMG/M
3300019029|Ga0193175_10159019All Organisms → cellular organisms → Eukaryota → Sar745Open in IMG/M
3300019039|Ga0193123_10281771All Organisms → cellular organisms → Eukaryota → Sar652Open in IMG/M
3300019043|Ga0192998_10121102All Organisms → cellular organisms → Eukaryota → Sar716Open in IMG/M
3300019049|Ga0193082_10717305All Organisms → cellular organisms → Eukaryota → Sar564Open in IMG/M
3300019049|Ga0193082_10818650All Organisms → cellular organisms → Eukaryota → Sar524Open in IMG/M
3300019051|Ga0192826_10098148All Organisms → cellular organisms → Eukaryota → Sar1046Open in IMG/M
3300019053|Ga0193356_10316512All Organisms → cellular organisms → Eukaryota → Sar547Open in IMG/M
3300019054|Ga0192992_10205899All Organisms → cellular organisms → Eukaryota → Sar643Open in IMG/M
3300019068|Ga0193461_107252All Organisms → cellular organisms → Eukaryota → Sar529Open in IMG/M
3300019091|Ga0192935_1025378All Organisms → cellular organisms → Eukaryota → Sar525Open in IMG/M
3300019094|Ga0193040_1008192All Organisms → cellular organisms → Eukaryota → Sar661Open in IMG/M
3300019099|Ga0193102_1029324All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300019105|Ga0193374_1016370All Organisms → cellular organisms → Eukaryota → Sar549Open in IMG/M
3300019123|Ga0192980_1088246All Organisms → cellular organisms → Eukaryota → Sar559Open in IMG/M
3300019126|Ga0193144_1108391All Organisms → cellular organisms → Eukaryota → Sar516Open in IMG/M
3300019129|Ga0193436_1034815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae798Open in IMG/M
3300019129|Ga0193436_1056811All Organisms → cellular organisms → Eukaryota → Sar603Open in IMG/M
3300019134|Ga0193515_1093861All Organisms → cellular organisms → Eukaryota → Sar503Open in IMG/M
3300019139|Ga0193047_1094293All Organisms → cellular organisms → Eukaryota → Sar612Open in IMG/M
3300019141|Ga0193364_10153099All Organisms → cellular organisms → Eukaryota → Sar503Open in IMG/M
3300019711|Ga0193993_1049089Not Available545Open in IMG/M
3300020069|Ga0197907_10314626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae632Open in IMG/M
3300020161|Ga0211726_10350694All Organisms → cellular organisms → Eukaryota → Sar602Open in IMG/M
3300020474|Ga0211547_10503193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae606Open in IMG/M
3300021134|Ga0214171_1028481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae774Open in IMG/M
3300021169|Ga0206687_1437762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae714Open in IMG/M
3300021185|Ga0206682_10370651All Organisms → cellular organisms → Eukaryota → Sar610Open in IMG/M
3300021323|Ga0210295_1015238All Organisms → cellular organisms → Eukaryota → Sar715Open in IMG/M
3300021334|Ga0206696_1526181All Organisms → cellular organisms → Eukaryota → Sar562Open in IMG/M
3300021342|Ga0206691_1631155All Organisms → cellular organisms → Eukaryota → Sar613Open in IMG/M
3300021345|Ga0206688_10208753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae576Open in IMG/M
3300021849|Ga0210304_1007216Not Available511Open in IMG/M
3300021912|Ga0063133_1079899All Organisms → cellular organisms → Eukaryota → Sar700Open in IMG/M
3300021930|Ga0063145_1045923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae584Open in IMG/M
3300022373|Ga0210319_1030908All Organisms → cellular organisms → Eukaryota → Sar523Open in IMG/M
3300023700|Ga0228707_1045727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae631Open in IMG/M
3300024293|Ga0228651_1102137All Organisms → cellular organisms → Eukaryota → Sar650Open in IMG/M
3300024532|Ga0256352_1095865All Organisms → cellular organisms → Eukaryota → Sar534Open in IMG/M
3300025185|Ga0208701_117939All Organisms → cellular organisms → Eukaryota → Sar506Open in IMG/M
3300025375|Ga0208259_1053991All Organisms → cellular organisms → Eukaryota → Sar543Open in IMG/M
3300025840|Ga0208917_1126293All Organisms → cellular organisms → Eukaryota → Sar910Open in IMG/M
3300026460|Ga0247604_1130602All Organisms → cellular organisms → Eukaryota → Sar553Open in IMG/M
3300026503|Ga0247605_1145733All Organisms → cellular organisms → Eukaryota → Sar569Open in IMG/M
3300027263|Ga0208446_1097752All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300027707|Ga0209443_1194668All Organisms → cellular organisms → Eukaryota → Sar715Open in IMG/M
3300027769|Ga0209770_10321234All Organisms → cellular organisms → Eukaryota → Sar586Open in IMG/M
3300027906|Ga0209404_10451129All Organisms → cellular organisms → Eukaryota → Sar845Open in IMG/M
3300030715|Ga0308127_1031946All Organisms → cellular organisms → Eukaryota → Sar644Open in IMG/M
3300030720|Ga0308139_1051891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae615Open in IMG/M
3300030726|Ga0308126_1057851All Organisms → cellular organisms → Eukaryota → Sar553Open in IMG/M
3300031062|Ga0073989_10004071All Organisms → cellular organisms → Eukaryota → Sar594Open in IMG/M
3300031113|Ga0138347_10463903All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300031121|Ga0138345_10686334All Organisms → cellular organisms → Eukaryota → Sar540Open in IMG/M
3300031542|Ga0308149_1032852All Organisms → cellular organisms → Eukaryota → Sar653Open in IMG/M
3300031556|Ga0308142_1059540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae568Open in IMG/M
3300031606|Ga0302119_10305362All Organisms → cellular organisms → Eukaryota → Sar593Open in IMG/M
3300031750|Ga0307389_11206725All Organisms → cellular organisms → Eukaryota → Sar506Open in IMG/M
3300031785|Ga0310343_11245104All Organisms → cellular organisms → Eukaryota → Sar562Open in IMG/M
3300032714|Ga0314686_10479207All Organisms → cellular organisms → Eukaryota → Sar614Open in IMG/M
3300032724|Ga0314695_1404897All Organisms → cellular organisms → Eukaryota → Sar517Open in IMG/M
3300034019|Ga0334998_0443451All Organisms → cellular organisms → Eukaryota → Sar735Open in IMG/M
3300034020|Ga0335002_0175952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1356Open in IMG/M
3300034122|Ga0335060_0548687All Organisms → cellular organisms → Eukaryota → Sar588Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine36.41%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.64%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water4.62%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.08%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.08%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.56%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.05%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.54%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.54%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.54%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.54%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.03%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.03%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.03%
Eutrophic PondEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Eutrophic Pond1.03%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.51%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.51%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.51%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.51%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.51%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.51%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.51%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.51%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.51%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.51%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.51%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.51%
MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Marine0.51%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.51%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.51%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral0.51%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002370Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnionEnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007162Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008624Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 250-2.7umEnvironmentalOpen in IMG/M
3300008764Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2065EnvironmentalOpen in IMG/M
3300008795Microbial communities from freshwater in the western basin of Lake Erie, USA - 882-2EnvironmentalOpen in IMG/M
3300008799Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample NO3-1EnvironmentalOpen in IMG/M
3300008800Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample NO3-2EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008856Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_3062EnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008957Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT2EnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009225Microbial communities of water from Amazon river, Brazil - RCM4EnvironmentalOpen in IMG/M
3300009235Microbial communities of water from Amazon river, Brazil - RCM10EnvironmentalOpen in IMG/M
3300009268Eukaryotic communities of water from the North Atlantic ocean - ACM43EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009327Microbial communities of water from the North Atlantic ocean - ACM30EnvironmentalOpen in IMG/M
3300009340Microbial communities of water from the North Atlantic ocean - ACM60EnvironmentalOpen in IMG/M
3300009344Microbial communities of water from the North Atlantic ocean - ACM58EnvironmentalOpen in IMG/M
3300009357Microbial communities of water from the North Atlantic ocean - ACM13EnvironmentalOpen in IMG/M
3300009390Microbial communities of water from the North Atlantic ocean - ACM34EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009516Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009717Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_236_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009748Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_210_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009750Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_206_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009753Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_190_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009754Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_198_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010034Coral microbial communities from Lord Howe Island, Old Settlement Bay, Australia - Cyphastrea 1 metagenomeHost-AssociatedOpen in IMG/M
3300010129Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_237_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011012Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPsEnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012705Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES047 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012710Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012711Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012712Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012720Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012748Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES045 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012754Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012763Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016697Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016923Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in L1 medium, 16 C, 25 psu salinity and 192 ?mol photons light - Alexandrium minutum CCMP 113 (MMETSP0328)Host-AssociatedOpen in IMG/M
3300017329Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/20 medium with seawater, no silicate, 19 C, 30 psu salinity and 167 ?mol photons light - Tiarina fusa LIS (MMETSP0472)Host-AssociatedOpen in IMG/M
3300017486Metatranscriptome of marine eukaryotic communities from Gulf of Mexico in f/2 medium with artificial seawater w/o silicate, 18 C, 28 psu salinity and 715 ?mol photons light - Lingulodinium polyedrum CCMP 1738 (MMETSP1033)Host-AssociatedOpen in IMG/M
3300018521Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000311 (ERX1782300-ERR1712011)EnvironmentalOpen in IMG/M
3300018543Metatranscriptome of freshwater lake microbial communities from Lake Tornetrask, Sweden - GS667_0p8EnvironmentalOpen in IMG/M
3300018550Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0EnvironmentalOpen in IMG/M
3300018597Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782201-ERR1712206)EnvironmentalOpen in IMG/M
3300018602Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782193-ERR1711945)EnvironmentalOpen in IMG/M
3300018604Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002362 (ERX1782200-ERR1712077)EnvironmentalOpen in IMG/M
3300018621Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001561 (ERX1782270-ERR1712225)EnvironmentalOpen in IMG/M
3300018636Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897)EnvironmentalOpen in IMG/M
3300018660Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000589 (ERX1782392-ERR1711993)EnvironmentalOpen in IMG/M
3300018668Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002464 (ERX1782441-ERR1712149)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018696Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000864 (ERX1782143-ERR1711870)EnvironmentalOpen in IMG/M
3300018709Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782278-ERR1712213)EnvironmentalOpen in IMG/M
3300018714Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001812 (ERX1782478-ERR1711985)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018814Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000047 (ERX1789515-ERR1719274)EnvironmentalOpen in IMG/M
3300018845Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809760-ERR1740122)EnvironmentalOpen in IMG/M
3300018852Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001606 (ERX1809471-ERR1739847)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019029Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000313 (ERX1789463-ERR1719383)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019068Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002414 (ERX1782336-ERR1711930)EnvironmentalOpen in IMG/M
3300019091Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001510 (ERX1782237-ERR1711876)EnvironmentalOpen in IMG/M
3300019094Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001489 (ERX1809466-ERR1739840)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019105Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001942 (ERX1782301-ERR1712219)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019141Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001937 (ERX1789668-ERR1719463)EnvironmentalOpen in IMG/M
3300019711Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MGEnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300021134Freshwater microbial communities from Trout Bog Lake, WI - 02JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021849Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022373Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.180 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023700Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024293Seawater microbial communities from Monterey Bay, California, United States - 63DEnvironmentalOpen in IMG/M
3300024532Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025185Marine microbial communities from the Deep Pacific Ocean - MP1482 (SPAdes)EnvironmentalOpen in IMG/M
3300025375Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026460Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027263Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027707Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030726Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1292_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031556Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_538_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031606Marine microbial communities from Western Arctic Ocean, Canada - AG5_TmaxEnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J14230_1021488113300001282FreshwaterLTKGKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSGCEKEEIPK*
B570J29631_10365613300002370FreshwaterYKITISPKKKKVKIEVNKIMVPAFLLGTAFNIEYWHRKYHSGTICKGVSNPQTSNALSGCEKEENCK*
Ga0007760_1020318623300004793Freshwater LakeMKEREKGLLTDNNKVVRFLISPKKKKAKIEVNKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0066830_1009911413300005433MarineMQRKERKERLKDEIEKPLLHSINLVRVVRLLISPKKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK*
Ga0079957_118998323300005805LakeKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSGCEKEEIPK*
Ga0075502_109190913300006357AqueousNER*ERKKDEREKPLLFNLVKVVRFLISPKKKKEEIEENKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIP*
Ga0075516_102355913300006384AqueousEREKPLLFNLVKVVRFLISPKKKKEEIEENKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIP*
Ga0075506_109872913300006401AqueousLADISWELP*KIGHY*KEREQRKKDEREKPLLFKRHKAVRFLISPKIKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEKEEIPK*V*RKYRQRIRM
Ga0075505_104330313300006571AqueousERKKDEREKPLLFNLVKVVRFLISPKKKKEEIEENKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIP*
Ga0079300_1016428613300007162Deep SubsurfaceMTENSMNEKNLENSKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSGCEKEEIPK*
Ga0105019_113023313300007513MarineMQRKERKERKKNEIEKPLLHSINLVRVVRLLISPNKKKIKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK*
Ga0102822_117845013300007558EstuarineEQRKKGEREKPLLFKRHKAVRFLISPKIKKVKIEVNKIMNPAFLLGTAFNIAYWDRKYHSGTICKGVSNTQTSNALSGCEKEEIPK*
Ga0102951_123685513300007725WaterLLLFKRHKVVRFLISPKNKKMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCVKEEIPK*
Ga0114346_112270913300008113Freshwater, PlanktonVEDMKVVRFVISPNKKKIIIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNVETSTALSGCDKEEIEKKDWKMNDER*
Ga0115652_111586013300008624MarineMQRKERKERKKNEKPLLHSINLVTVVRLLISPNKKKIKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK*
Ga0103913_10033713300008764Surface Ocean WaterMRERKERKKNEREKPLLQSINLVKVVRFLISPKKKRAKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103701_10243913300008795Lake WaterMLKRHKAVRFLISPKIKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0103766_102520723300008799Eutrophic PondVKDEREKRLLFKRHKAVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSGCEKEEIPK*
Ga0103767_102091813300008800Eutrophic PondTKGKRHKVVRFLISPKKKRAKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREENPK*
Ga0103951_1017327313300008832MarineVNAARVHISPKNKKKKIEDNKMVNPAFLLGTAFRIAYWHRKYHSGTICTGVINAQASNALSGCESEEMLKCV*
Ga0103883_104471013300008835Surface Ocean WaterMQTKERKERKKNEIEKPLLHSINLVRVVRLLISPNKNKMKIEVSKIMKPAFLLGIAFNIAYWQRKYHSGTICKGVSNALTSKALSGCEREDIPKCT*
Ga0103902_10026213300008856Surface Ocean WaterPIQRKERKERKKNEIEKPLLQSINLVKVVRFLISPKKKRARIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103733_100359933300008930Ice Edge, Mcmurdo Sound, AntarcticaVCELIRRPCTHRGVSPKERKERKKNEREKPLLQSINLVKVVRFLISPKKKRARIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVTNPHTSNALSGCDKE*
Ga0104239_101384013300008957FreshwaterMKERLKGLFTDNKNVVRLLTSPNDKNNKMEVNKIMNPAFLLGTAFNIAYWMRKYHSGTICKGVIKGLACSALSG*
Ga0104259_100492313300008958Ocean WaterPLLQSINLVKVVRFLISPKKKRARIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103502_1022944923300008998MarineLTKGKRLKVVRFLISPNKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQSSKALSVCEKEEIPK*
Ga0102816_127740313300008999EstuarineKWKYLEKKTKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEENCK*
Ga0105098_1069085523300009081Freshwater SedimentVRRKKEYVNSKSKERPARRNVVRFLISPKKKKVKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNGQTSNALSGCEKEEIPK*
Ga0114980_1012069833300009152Freshwater LakeIQRNEIVRRKKEYVKEREKGLLIDNNKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEQIPK*
Ga0114978_1056986513300009159Freshwater LakeMSRKKEYVKEREKGLLIDSKKVDRLRISPKKKRVKIEVNNTMNPAFLLGTAFSIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0114970_1042217113300009163Freshwater LakeMKEREKGLLIDNKKVVRFLISPKKKKVKMEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0103842_103123413300009216River WaterRKKNEIEKPLLQSINLVKVVRFLISGKKKKMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103842_103253413300009216River WaterMQRKERKERLKNEIEKPLLHSINLVRVVRLLISPKKKRMKIEVSKTMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREVIPK*
Ga0103851_103994123300009225River WaterVYLISPKKKRAKIEVNKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0103857_1003646123300009235River WaterLVLLLFKRHKVVRFIISPNSNKIRIEVNKIMNPAFLFGKAFNIAYWHRKYHSGTICKGVSNAQA
Ga0103874_100062013300009268Surface Ocean WaterMQTKERKERKKNEIEKPLLHSINLVRVVRLLISPNKNKMKIEVSKIMKPAFLLGIAFNIAYWQRKYHSGTICKGVSNALTSKALSGCEREDTPK*
Ga0103878_100158723300009274Surface Ocean WaterMLSDADLRISTLLLDGEKNENEKPLLLCTLLVKLVRFLTSPNKKKIHIEVHKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVTNPHTSNALSGCDKE*
Ga0103843_10251413300009327River WaterVRFLISPKKKRARIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0103838_100096113300009340River WaterKKNEIEKPLLHSINLVRVVRLLISPNKNKMKIEVSKIMKPAFLLGIAFNIAYWQRKYHSGTICKGVSNPLTSKALSGCEREDIPKCT*
Ga0103834_100453213300009344River WaterMIRKERKERLKNEIEKPLLHSINLVRVVRLLISPKKKRMKIEVSKTMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDTPK*
Ga0103827_100953913300009357River WaterRKKLEREKLLLFKRHKVVRFLISPKSKRMRIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0103831_102129623300009390River WaterMQRKERKERLKNEIEKPLLHSINLVRVVRLLISPKKKRMKIEVSKTMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDTPK*
Ga0103742_101054613300009402Ice Edge, Mcmurdo Sound, AntarcticaMQRKERKERKKNEIEKPLLHSINLVRVVRLLISPNKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDTPK*
Ga0114994_1063879813300009420MarineMQRKERKVRLKDEIEKPLLHSINLVRVVRLLISPNKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK*
Ga0115005_1027068313300009432MarineMQRKERKERKKDEIEKPLLHSINLVRVVRLLISPNKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK*
Ga0115008_1109086113300009436MarineDEIEKPLLHSINLVRVVRLLISPNKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK*
Ga0115007_1075223713300009441MarineMTERKKDEREKPLLFNLVKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEE
Ga0129359_102479613300009516Meromictic PondMKKEEREKPLLFKRHKVVRFLISPKSKRMRIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGC
Ga0115004_1066443613300009526MarineMQRKERKERLKDEIEKPLLDSINLERVVRLLISPKKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK*
Ga0115006_1048645933300009544MarineVSHRDEREKPLFNLVKVVRFLISPKKNKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSDALSGCEKEEIPR*
Ga0115013_1146245723300009550MarineMQTKERKERKKDEIEKPLLHSINLVRVVRLLISPNKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPL
Ga0115101_114430013300009592MarineEKPLLQSINLVKVVRFLISPKKKRMRIEVNKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGWEREETPK*
Ga0115011_1113082313300009593MarineMQRKERNERLKDEIEKPLLVSINLVRVVRLLISTKKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK*
Ga0123375_1003413300009717MarineIKERKKNEREKPLLQSINLVKVVRFLISGKKKKMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0123361_101869323300009741MarineLTKGKRQKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0123370_110697113300009748MarineMQTKERKEKKKNEIEKPLLHSINLVRVVRLLISPNKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDIPK*
Ga0123370_112780713300009748MarineINLVKVVRFLISPKKKRMRIEVNKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGWEREETPK*
Ga0123368_109839113300009750MarineIQRKERKERKKNEIEKPLLPVSNLVKVVRFLISPKKKRAKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVRNAQASNALSGCEREETPK*
Ga0123360_107999913300009753MarineMQRKERKERLKNEIEKPLLDSINLVRVVRLLISPKKKKMKIEVNKIMKPAFLLGIAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDTPK*
Ga0123364_113238213300009754MarineMQTKERKEKKKNEIEKPLLHSINLVRVVRLLISPNKNKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDIPK*
Ga0126342_1020215513300010034CoralVVRFLISPKKKKVKIEVKKIMNPEFLFEIPFKIPYWHRKYHSGTICKGVSNSQTSNALSGCEKEEIKK*
Ga0123376_114943713300010129MarineMERKERRVRKKNEIEKPLLHSINLVRVVRLLISPKKKKMKIEVSKIMKPAFLFGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDIPK*
Ga0150979_106692513300011012MarineREREKKNEREKLLLFKRHKVVRFLISPKKKRAKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0138260_1092727113300012419Polar MarineSINLVKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0129353_174179113300012525AqueousPIQRKERKTKNRNEREKLLLQSINLVNAAINLISPKKKKMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNALASNALSGCEREEIP*
Ga0157555_107283023300012705FreshwaterMKEREKGLLIDNMKVVRFLISPNKKNIKIEVNNTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPKCVCRKYRERTRVKA*
Ga0157550_122973223300012710FreshwaterMKEREKGLLTDNMKVVRFLISPNKKNIKIEVNNTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPKCVCRKYRERTRVKA*
Ga0157607_116399313300012711FreshwaterLTKGKRHKVVRFLISPKKKRVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGCEREEIPK*
Ga0157598_100272513300012712FreshwaterLTKGKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGCEREQIPK*
Ga0157613_116215313300012720FreshwaterREREKKNEREKLLLFKRHKVVRFLISPNNNKMRIEVNNIMNPAFLFGIAFNIAYWHRKYHSGTICKGVSNAQASNALSGCDREETPK*
Ga0157553_104795013300012748FreshwaterKQQLGLPFHAAVISPKKKKMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0138278_115188313300012754Freshwater LakeVRRKNEYMKKREKGLLIDNMKVVRFLISPKKKKVKIEVNNIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0138272_110394613300012756Freshwater LakeDIARRKNEYMKEREKGLLTDNKKVVRFLTSPNKNRMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPKCV*
Ga0138289_114109523300012763Freshwater LakeMKEREKGLLTDNKKVVRFLISPNKKKAKIEVNKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0138267_103987913300012767Polar MarineMKERKKNEIEKPLLQSINLVKVVRFLISPKKKKMRIEVNKIMNPAFLLGTAFNIAYWQRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0160422_1037398313300012919SeawaterMQRKERKERLKDEIEKPLLHSINLVRVVRLLISPKKKKMKIEVSKIMKPAFLFGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK*
Ga0129343_120993013300012967AqueousPLLQSINLTKVVRFLISPNKKRMKTEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGCEREETPK*
Ga0164296_113973513300013093FreshwaterVKDEREKPLLFKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQCLIVYFSV*
Ga0170791_1396589923300013295FreshwaterMKVVRFVISPKKKKITIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAEASTALSGCDKEEIEKKDWKMNNER*
Ga0180057_115627023300016697FreshwaterEKKNEREKLLLFKRHKVVRFLISPNNNKMRIEVNNIMNPAFLFGIAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0186368_10694713300016923Host-AssociatedVVRFLISPKKKRVRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNALASKALSGCEREETPK
Ga0186525_102201723300017329Host-AssociatedLTKGKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQTSKALSGCDKEETPK
Ga0186434_104313223300017486Host-AssociatedLTKGKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQTSKALSGCDKEEIPK
Ga0193171_10712723300018521MarineLTKGKTHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0193171_10712823300018521MarineLTKGKTHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0188820_10141913300018543Freshwater LakeVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQASNALSGCEKEEIPK
Ga0188833_10086513300018550Freshwater LakeERKKNEREKPLLQSINLVKVVRFLISPKKKRTKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQASNALSGCEKEEIPK
Ga0193035_102300113300018597MarineINLVKVVRFLISPKKKRMRIEVNKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0193182_100658113300018602MarineIQTDNRKKNVIEKPFLQSINLIKVDKFLISPNKNKVRIEVNKIMNPAFLLGTAFNIAYXHRKYHSGTICNGVSSEQASNALSGCEREEIPRCVCKKYR
Ga0193447_102258223300018604MarineLTKGKTHKVVRFLISPKIKRMRIEVNKVMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0193093_102848813300018621MarineMQRKERKERKKNEIEKPLLQSINLVKVVRFLISPKKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDTPK
Ga0193377_101139423300018636MarineLTKGKRQKVVRFLISPKKKRVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGCEREETPK
Ga0193130_105542813300018660MarineMEFRRHKVVRFLISPKKKKMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0193013_106041213300018668MarineSINLIKVDKFLISPNKHKVRIEVNKIMNPAFLLGTAFNIAYXHRKYHSGTICKGVSNEQASNALSGCEREEIPRCVCK
Ga0192917_107108013300018690MarineLTKGKTHKVVRFLISPKIKRVRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGCEREETPK
Ga0193110_100623313300018696MarineMKKDNKKLILFMRTKEVTFLISPNMNKNKIEVNKIMNPEFLLGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREENPKCVCRKYR
Ga0193209_106165623300018709MarineLTKGKTHKVVRFLISPKIKRVRIEVNKVMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0193349_106170813300018714MarineSINLVKVVRFLISPKKKRVKIEVNKIMNPAFLLGTAFNIAYWLRKYHSGTICKGVSREEASNALSGCDKEEIPK
Ga0193147_108287013300018747MarineLFNRHKVVRFLISPKKKRVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0192924_105083813300018764MarineMEFRRHKVVRFLISPKKKKTKTEVNKIMNPEFLLGTAFNIAYWHRKYHSGTICKGVSNVQASNALSECEREETPK
Ga0193478_105321913300018769MarineKNEREKLLLFKRHKAVRFLISPKTKKMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0193478_106459613300018769MarineKNEREKLLLFKRHKAVRFLISPKTKKMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQSSKALSVCEKEEIPK
Ga0193197_102101123300018783MarineLTKGKRQKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0193357_108899313300018794MarineMEFRRHKVVRFLISPKKKKMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0193075_109084513300018814MarineERYISCGNXAPIQRIQTDNRKKNVIEKPFLQSINLIKVDKFLISPNKNNERIEVNKIMNPAFLLGTAFNIAYXHRKYHSGTICNGVSSEQASNALSGCEREEIPRCVCKKYR
Ga0193042_109644413300018845MarineKDEREKQLLTKGKRLKVVRFLTSPNKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQSSKALSVCEKEEIPKYSW
Ga0193042_110651713300018845MarineKDEREKQLLTKGKRLKVVRFLTSPNKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQGSKALSVCEREETPK
Ga0193284_108263123300018852MarineMQRKERKERIKNEIEKPLLHSINLVRVVRLLISPKKKKMKIEVSKTIKPAFLLGTAFNIAYXHRKYHSGTICKGVSNAQA
Ga0193192_104960613300018860MarineERKKNEIEKPLLQSINLVKVVRFLISPKKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0193244_101448813300018903MarineLTKGKRLKVVRFLVSANKNKLRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0193426_1002041923300018942MarineKKNEIEKPLLQSINLVKVVRFLISPNKKRMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0193066_1008865113300018947MarineEKPLLQSINLVKVVRFLISPKKKRAKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0193531_1010564823300018961MarineLTKGKRLKVVRFLVSANKNKLRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQSSKALSVCEKEEIPK
Ga0193531_1014384413300018961MarineKDEREKQLLTKGKRLKVVRFLISANKNKLKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQSSKALSVCEKEEIPK
Ga0193293_1010871813300018966MarineMKRKETNTAKNKEIENPLLLSINLVKVVKFRISPKKNKQNIEVNKIMNPAFLLGTAFNIAYWHRKYH
Ga0193178_1006923013300018967MarineIEKPFLQSINLIKVDKFLISPNKNKMRIEVNKIMNPAFLLGTAFNIAYXHRKYHSGTICKGVSNEQASNALSGCEREEIPRCVCK
Ga0193178_1008370823300018967MarineINLIKVDKFLISPNKNKVRIEVNKIMNPAFLLGTAFNIAYXHRKYHSGTICNGVSSEQASNALSGCEREEIPRCVCKKYR
Ga0192894_1024074813300018968MarineIQRKEKTTKNKNEREKPLLQSINLTNAATNLISPKKKRTKIEVNNIMNPAFLLGIAFNIAYWERKYHSGTICKGVRREQASNALSGCEREETPK
Ga0193143_1016606113300018969MarineLNVVNDVISPNKKSIRMEVRSIMNPEFLLGTAFNIAYWQRKYHSGTICNGVSNGXTCKALSGXESVEIPXXHXII
Ga0193254_1004143033300018976MarineRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQSSKALSVCEKEEIPK
Ga0193353_1019489713300018977MarineMQRKERKERLKNEIEKPLLHSINLVRVVRLLISPKKKKMKIEVSKTMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDTPK
Ga0193353_1021489413300018977MarineEKPLLQSINLVKVVRFLISPKKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAHASNALSGCEREEIPKXVCRKYR
Ga0193353_1024309423300018977MarineEKPFLQSINLIKVDKFLISPNKNKMRIEVNKIMNPAFLLGTAFNIAYXHRKYHSGTICKGVSNEQASNALSGCEREEIPRCVCK
Ga0192968_1012861613300018981MarineEREKLLLFKRHKVVRFLISPKKKRARIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0192968_1018431413300018981MarineLLFKRQKVVRFLISPKKKRAKIEVNKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0193136_1025344013300018985MarineINLVKVVRFLISPKKKRMRIEVNKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEMPK
Ga0193136_1026132123300018985MarineINLVKVVRFLISPKKKRMRIEVNKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0193554_1031949723300018986MarineMEFERHKVVRFLISPKKKRTKTEVNKIMNPELLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSECEREETPK
Ga0193554_1031950323300018986MarineMEFERHKVVRFLISPKKKRTKTEVNKIMNPELLLGTAFNIAYWHRKYHSGTICKGVSNPQASNALSECEREETPK
Ga0193196_1015753223300019007MarineIQRIQTDNRKKNVIEKPFLQSINLIKVDKFLISPNKNNERIEVNKIMNPAFLLGTAFNIAYXHRKYHSGTICNGVSSEQASNALSGCEREEIPRCVCKKYR
Ga0193569_1037101113300019017MarineKDEREKQLLTKGKRLKVVRFLISANKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVRNPQSSKALSVCEKEEIPKCIRKSLPS
Ga0193569_1041834813300019017MarineKDEREKQLLTKGKRLKVVRFLISANKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVRNPQSSKALSVCEKEEIPK
Ga0193175_1015901923300019029MarineLTKGKTHKVVRFLISPKKKRVRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0193123_1028177113300019039MarineMTTRKKNEREKPLLFKRQKVVKFLISPNKKKAKIEDNKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEN
Ga0192998_1012110213300019043MarineFSXGNXAPMNRKDREIKNKNEREKPLLQFINLTNALTNLISPNKNKIKMEVNKIMNPAFLLGIAFNIAYXHRKYHSGTICKGVSNAQASNALSGCEREEIPKXVCKKKRKQ
Ga0193082_1071730513300019049MarineKKNEIEKPLLQSINLVKVVRFLISPNKKRMRIEVNKAMNPAFLLGIAFKIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0193082_1081865013300019049MarineKKNEREKLLLFKRHKVVRFLISPKSKRMRIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0192826_1009814813300019051MarineIQTDNRKKNVIEKPFLQSINLIKVDKFLISPNKNNERIEVNKIMNPAFLLGTAFNIAYXHRKYHSGTICNGVSSEQASNALSGCEREEIPRCVCKKYR
Ga0193356_1031651213300019053MarineERKERKKNEREKPLLTKGKTHKVVRFLISPKIKRMRIEVNKVMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0192992_1020589913300019054MarineVKKKKYEIMKPLLQFINQHIVVRFLISPKKKKQQIDVTKTMNPAFLFGIAFNIAYXHKKYHSGTICKGVSNAQASNALSGCERIEIPKLHXRKYRQRIKEI
Ga0193461_10725213300019068MarineLFKRHKAVRFLISPKIKKMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0192935_102537823300019091MarineLTKGKRHKVVRFLISPKKMRAKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0193040_100819223300019094MarineMEFRRHKVVKFLISPKKKKTKTEVNKIMNPEFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0193102_102932413300019099MarineNKRHKVVRFLDSPKKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASDALSGCEREEIPK
Ga0193374_101637013300019105MarineITEKKKDEIKNEEPLLQYINLVKVVKFLISPNKMKINIEVNNIMNPAFLLGTAFNIPYWHRKYHSGTICKGVINPLTSNALSGCDKLYIPK
Ga0192980_108824613300019123MarineEKPLLQSINLVKVVRFLISPKKKRARIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASDALSGCEREEIPK
Ga0193144_110839113300019126MarineLTKGKRQKVVRFLISPKKKRVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASTALSGCDKEEIPK
Ga0193436_103481513300019129MarineMQRKERKERKKNEIEKPLLHSINLVRVVRLLISPNKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNDQASNALSGCDKEETPK
Ga0193436_105681113300019129MarineMERKERKMEEKRLIEKPLLQXINIVNALMSLISANKNKMKIEVNKIMNPEFLFGTAFNIAYWHRKYHSGTICKGVSNALASNALSGCDKEEIP
Ga0193515_109386113300019134MarineCGNWEPIQINARKQRKKNDKLKPLLQSCNLANVDRFLTSVNKKKMNIEVNRAPNPAFLLGIAFKIAYWHRKYHSGTMCKGVSNAQASTALSGCDKVEMPACV
Ga0193047_109429313300019139MarineRKKDEREKPLLFKRHKAVRFLISPKIKKNVIEVNKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0193364_1015309923300019141MarineDKFLISPNKNKMRIEVNKIMNPAFLLGTAFNIAYXHRKYHSGTICKGVSNEQASNALSGCEREEIPRCVCK
Ga0193993_104908913300019711SedimentKEKPLLFKRHKAVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0197907_1031462613300020069Corn, Switchgrass And Miscanthus RhizosphereVRFLISPKKKKAKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEKEKREK
Ga0211726_1035069413300020161FreshwaterINEIVRRKKEYVKEREKGLLIDNKKVVRFLISPKKRKVNIEVKRIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQTSNALSGCEKEEIPK
Ga0211547_1050319313300020474MarineSINLVKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0214171_102848123300021134FreshwaterRFVISPKKKKIIIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNVETSTALSGCDKEEIEKKDWKMNNER
Ga0206687_143776223300021169SeawaterRFLISPKKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0206682_1037065113300021185SeawaterVKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0210295_101523813300021323EstuarinePIQRKERTPRKKNEREKPLLQSINLVKVVRFLISPKKKKAKIEVNNIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0206696_152618113300021334SeawaterRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEKI
Ga0206691_163115513300021342SeawaterMQRKERKERKKNEIEKPLLHSINLVTVVRLLISPNKKKIKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK
Ga0206688_1020875313300021345SeawaterMQRKERKERLKNEIEKPLLHSINLVRVVRLLISPKKKRMKIEVSKTMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSK
Ga0210304_100721613300021849EstuarineIHFPKIISRCPKKKKVKIEVNKIMVPAFLLGTAFNIEYWHRKYHSGTICKGVSNPQTSNALSGCEKEENCK
Ga0063133_107989923300021912MarineLTKGKRLKVVRFLISANKNKLKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQSSKALSVCEKEEIPK
Ga0063145_104592313300021930MarineINLVKVVRFLISPKKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNXQASNALSGCEKEEIPK
Ga0210319_103090813300022373EstuarineKVVRFLISPKIKKMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0228707_104572723300023700FreshwaterMKERLKGLFTDNKNVVRLLTSPNDKNNKMEVNKIMNPAFLLGTAFNIAYWMRKYHSGTICKGVIKGLACSALSG
Ga0228651_110213723300024293SeawaterERKKDEREKPLLFNLVKVVRFLISPKKKKEEIEENKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIP
Ga0256352_109586513300024532FreshwaterREKKNEREKLLLFKRHKVVRFLISPKSKKMRIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQACNALSGCEREETPK
Ga0208701_11793923300025185Deep OceanKDEIEKPLLLCILLVKLVRFLISPNKKKMRIEVHKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0208259_105399113300025375FreshwaterVKDEREKPLLFKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIEYXHRKYHSGTICKGVSNPQTSNALSGCEKEEIPKXVXRRYRQSIRMKPKK
Ga0208917_112629313300025840AqueousKKDEREKPLLFNLVKVVRFLISPKKKKEEIEENKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIP
Ga0247604_113060213300026460SeawaterMVIQNEIEKPLLQLINLTKTVKFLISPNKYKRRIDVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0247605_114573313300026503SeawaterERKKNEIEKALLQSINLVKVVRFLISAKKKKMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0208446_109775213300027263EstuarineHKAVRFLISPKKKKEKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0209443_119466813300027707Freshwater LakeMKEREKGLLIDNKKVVRFLISPKKKKVKMEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0209770_1032123413300027769Freshwater LakeVRIKKEYMKEREKGLLIDNKKVVRFLISPKKRKHKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0209404_1045112913300027906MarineMQRKERNERLKDEIEKPLLVSINLVRVVRLLISPKKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSN
Ga0308127_103194623300030715MarineLTKGKRLKVVRFLISPKKKRVRTEVNKTMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASKALSGCEREEIPK
Ga0308139_105189113300030720MarineKNEIEKPLLQSINLPKVVRFLISPKKKRIKIEVNKIMNPAFLLGTAFNIAYWQRKYHSGTICKGVSNAQASNALSGWEREETPK
Ga0308126_105785113300030726MarineLQNHKEEMAIENEREKPLLLCTLLVKLVRFLTSPNKKKIHIEVHKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVTNPHTSNALSGCDKE
Ga0073989_1000407113300031062MarineERKKNEIEKPLLQSINLVKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKA
Ga0138347_1046390313300031113MarineQSINLVKVVRFLISPKKKKVKIEVNKIMNPAFLFGTAFNMANWQRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0138345_1068633413300031121MarineVVRFLISPKKKRARIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSDALSGCEKEEIPK
Ga0308149_103285213300031542MarineAPIQRKERKERKKNEIEKPLLQSINLVKVVRFLISPKKKRIRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNGQASNALSGCEREEIPK
Ga0308142_105954013300031556MarineVERKERKKNEIEKPLLQSINLVKVVRFLISPKKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREE
Ga0302119_1030536213300031606MarineREKPLLFKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVFNPQTSNALSGCEKEEIPK
Ga0307389_1120672523300031750MarineLLCTLLVKLVRFLISPNKKKIHIEVHKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSDALSGCEKEEIPK
Ga0310343_1124510413300031785SeawaterMQRKERKERLKDEIEKPLLDSINLVRVVRLLISPKKKKMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK
Ga0314686_1047920713300032714SeawaterEREKQLLTKGKRLKVVRFLISPNKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQGSKALSVCEREETPK
Ga0314695_140489723300032724SeawaterMHWGNYEREKQLLTKGKRLKVVRFLTSPNKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSGCEKEEIPK
Ga0334998_0443451_305_5353300034019FreshwaterLTKGKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0335002_0175952_1099_13563300034020FreshwaterKKDEREKPLLTKGKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSGCEKEEIPK
Ga0335060_0548687_239_4693300034122FreshwaterLTKGKRHKVVRFLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.